CAZyme Information: MGYG000004340_00801

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium
• CAZyme ID: MGYG000004340_00801
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
506	MGYG000004340_25|CGC1	55532.45	4.4403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004340	2211293	MAG	Israel	Asia

• Gene Location: Start: 18128; End: 19648 Strand: -

Full Sequence      

MAQFVILTPDSLKELRVGNERLVSYNVEMTEVTGGTFWKAYTPGQIAGTEPFVVKNPFLG
NATASNDLMQYYDPINLYDEKLRKLAKEIGPAWVRVSGSWSTKTYYDFDGHTNGVIPEGY
NAILTREQWIGVLDFCKELGAKLLISVADCEGLHHAEEPWNPSQAEQIFALSKEYGVQID
AAEFVNEPNLLSMSGCPKGYTAQQFAQNEDIFARWLKANYPECLYVGPCTTEGAAGPTAD
SKKAMGGGIGDILPQVSTDALMEGTQEKLDVYSYHYYNGVSERLASIMPMSHWDGSRALS
EEYLEVAPNMAKFHATKRDAYCPEGEMWVTEAGDAGGGGDTWASTYLDVPRTLNELGSFS
AITRGIIFHNTLASSDYGYLKPEVFDPRPNYFAVLLWNRLMGTTVYDAAEPIREGAHVYA
HSRADGKPGVAYLVINNSETDTTTVTLPKDAEVYQLSAETLRSQTMRCNGKDLVLGENNT
LPEIAPVPAAAGDLVLPAATCTFIVL

Enzyme Prediction     

No EC number prediction in MGYG000004340_00801.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	75	506	3.6e-70	0.9406593406593406

CDD Domains     

MGYG000004340_00801 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN98036.1	7.34e-235	1	506	1	509
SNU86930.1	3.11e-214	1	506	1	507
ASL34473.1	3.34e-214	1	506	1	509
AYB02458.1	3.34e-214	1	506	1	509
AHY15492.1	3.34e-214	1	506	1	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RG8_A	1.45e-10	121	506	6	378	ChainA, Heparanase 50 kDa subunit [Homo sapiens]
5LA4_A	1.79e-08	50	506	13	500	Crystalstructure of apo human proheparanase [Homo sapiens],5LA7_A Crystal structure of human proheparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens]
5E8M_A	5.68e-08	143	506	18	380	Crystalstructure of human heparanase [Homo sapiens],5E97_A Glycoside Hydrolase ligand structure 1 [Homo sapiens],5E98_A Crystal structure of human heparanase in complex with HepMer M04S02a [Homo sapiens],5E9B_A Crystal structure of human heparanase in complex with HepMer M09S05a [Homo sapiens],5E9C_A Crystal structure of human heparanase in complex with heparin tetrasaccharide dp4 [Homo sapiens],5L9Y_A Crystal structure of human heparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens],6ZDM_AAA Chain AAA, Heparanase [Homo sapiens]
5L9Z_A	1.33e-07	143	506	18	380	Crystalstructure of human heparanase nucleophile mutant (E343Q), in complex with unreacted glucuronic acid configured aziridine probe JJB355 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L608	1.91e-13	75	487	72	510	Heparanase-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At5g61250 PE=2 SV=1
Q9LRC8	2.36e-12	328	487	326	492	Baicalin-beta-D-glucuronidase OS=Scutellaria baicalensis OX=65409 GN=SGUS PE=1 SV=1
Q8WWQ2	4.10e-10	144	506	210	581	Inactive heparanase-2 OS=Homo sapiens OX=9606 GN=HPSE2 PE=1 SV=3
X4Y2L4	4.60e-10	75	484	40	458	Hyaluronoglucuronidase OS=Hirudo nipponia OX=42736 PE=1 SV=1
B2RY83	7.17e-10	144	506	210	581	Inactive heparanase-2 OS=Mus musculus OX=10090 GN=Hpse2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004340_00801.