CAZyme Information: MGYG000004341_01319

Basic Information

• Species: CAG-110 sp000435995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp000435995
• CAZyme ID: MGYG000004341_01319
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		34502.56	8.7647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004341	2568452	MAG	Israel	Asia

• Gene Location: Start: 44719; End: 45678 Strand: +

Full Sequence      

MSNSNLVTYTHISPNRTSPRNKPITKITIHHMAGNLTLEQCGNIFANYGRGASANYGIDS
KGHIGQFVDERDRSWCSSNADNDHVAVTIEVANDGGAPDWHVSDAALASLIDLCVDICRR
NGIQRLNYTGDKGGNLTMHKWFAATACPGPYLESKFPYIAQAVNDRLGQSDKPSGSEQLY
RVRKSWADAKSQIGAYAVLDNAKRAADQHPGYAVFGGDGKMVYGGQSAVYTVQSGDTLSG
IASKYGLTYQALAAYNGLSNPNLIRVGQQIKIPSKKSVDEIAREVLRGLWGNGAEREKRL
TAAGYDYAAVQQRVNALLG

Enzyme Prediction     

No EC number prediction in MGYG000004341_01319.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	230	273	4.7e-17	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01510	Amidase_2	1.19e-24	23	150	1	121	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
pfam08230	CW_7	2.51e-18	279	318	1	40	CW_7 repeat. This domain was originally found in the C-terminal moiety of the Cpl-7 lysozyme encoded by the Streptococcus pneumoniae bacteriophage Cp-7. It is also found in the cell wall hydrolases of human and life-stock pathogens. CW_7 repeats make up a cell wall binding motif.
cd00118	LysM	6.19e-17	229	272	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	1.04e-16	230	273	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd06583	PGRP	4.71e-16	23	151	1	126	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE87697.1	8.64e-73	1	204	1	202
AFB76124.1	2.27e-64	1	274	6	242
QUO22979.1	1.23e-37	3	274	188	505
ADB89215.1	7.87e-37	3	194	15	218
AFB75734.1	8.66e-37	3	274	188	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CVD_A	1.14e-07	281	318	4	41	ChainA, LYSOZYME [Streptococcus phage CP-7]
5I8L_A	5.25e-07	276	318	6	48	ChainA, Lysozyme [Streptococcus phage CP-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q49UX4	1.36e-07	228	277	86	134	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q5HRU2	1.03e-06	225	273	144	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q8CMN2	1.03e-06	225	273	144	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q4L3C1	1.88e-06	223	277	83	136	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=sle1 PE=3 SV=1
Q6GHI8	2.17e-06	226	279	173	226	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=lytN PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004341_01319.