CAZyme Information: MGYG000004345_00554

Basic Information

• Species: Streptococcus thermophilus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus thermophilus
• CAZyme ID: MGYG000004345_00554
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227	MGYG000004345_5|CGC1	23337.84	5.289

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004345	1760385	MAG	Israel	Asia

• Gene Location: Start: 37719; End: 38402 Strand: +

Full Sequence      

MFKKSYKGRRIKLAVKKSLAVPVAIVTSFIVILAVSLSPLVNKGLVNAFSDSVIPTPSTT
STTSESTADLVKSTEVSSSKENKEKVKESKAQSETTTETVGASEKPQSESATTASIDATF
TQNNGAASSVAASTTGNGSVIISNGNTAGEIGSYAAAQMAAVTGVPQSTWESIIARESNG
DYTVASSSGASGLFQTMPGWGSTATVEDQIQSALNAYNAQGLSAWNY

Enzyme Prediction     

No EC number prediction in MGYG000004345_00554.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13925	RPF	1.53e-09	168	225	1	68	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
cd00254	LT-like	0.002	172	202	6	36	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00442	Lyz-like	0.007	169	215	1	58	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATH75448.1	2.18e-131	1	227	1	227
CAD0166394.1	2.18e-131	1	227	1	227
QHD71358.1	2.18e-131	1	227	1	227
CAD0166110.1	2.18e-131	1	227	1	227
QKM73636.1	2.18e-131	1	227	1	227

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CMZ9	1.30e-31	139	225	147	233	Probable transglycosylase IsaA OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=isaA PE=3 SV=1
Q5HL49	1.30e-31	139	225	147	233	Probable transglycosylase IsaA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=isaA PE=3 SV=1
Q6GDN1	6.60e-27	139	227	145	233	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=isaA PE=3 SV=1
Q2YWD9	2.56e-26	139	227	145	233	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=isaA PE=3 SV=1
Q6G6A5	9.89e-26	139	227	145	233	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=isaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.394144	0.600988	0.002486	0.001101	0.000482	0.000792

TMHMM  Annotations     

start	end
19	41