CAZyme Information: MGYG000004345_01401

Basic Information

• Species: Streptococcus thermophilus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus thermophilus
• CAZyme ID: MGYG000004345_01401
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242	MGYG000004345_15|CGC1	26474.94	4.1888

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004345	1760385	MAG	Israel	Asia

• Gene Location: Start: 41666; End: 42394 Strand: -

Full Sequence      

MKEGLYVSSFKEVFCFYSGGFFCSLFLVLAFTTDRKNDNSVTAKAEASYNQTTTAFIDSI
GETARQIGQDYNIYASVLIAQAILESNSGQSGLSQAPYYNFFGIKGSYNGNSVTMRTWED
DGTGNTYEIDEPFRSYGSLSDSLADYAALMTSSTYSGTWKSNTSSYADATQTLTGTYATD
SLYASKLNSIIAYYGLTIYDQAPVTQATGSSSGLVWNSYRGSYTDAETLSIDVAWASYKN
YK

Enzyme Prediction     

No EC number prediction in MGYG000004345_01401.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	61	196	3.6e-29	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK08581	PRK08581	4.36e-60	50	200	317	472	amidase domain-containing protein.
COG1705	FlgJ	1.81e-59	16	202	6	190	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	4.27e-51	38	242	125	349	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	4.87e-27	48	200	3	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	8.92e-23	50	200	157	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD0119630.1	1.33e-169	1	242	1	242
CAD0173686.1	1.33e-169	1	242	1	242
AOD26930.1	1.33e-169	1	242	1	242
CAD0126969.1	1.33e-169	1	242	1	242
CAD0181980.1	1.33e-169	1	242	1	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	2.53e-42	31	200	10	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	3.46e-38	53	200	60	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	6.15e-08	56	191	6	145	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	7.68e-08	56	191	6	145	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39046	7.36e-37	53	213	62	223	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q2G222	2.01e-36	53	200	320	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P37710	1.03e-34	48	213	175	342	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9CIT4	1.52e-30	53	213	62	225	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	3.96e-30	56	202	65	216	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999321	0.000443	0.000101	0.000002	0.000001	0.000168

TMHMM  Annotations     

start	end
13	32