CAZyme Information: MGYG000004345_01457

Basic Information

• Species: Streptococcus thermophilus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus thermophilus
• CAZyme ID: MGYG000004345_01457
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
194	MGYG000004345_16|CGC1	22071.3	9.9322

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004345	1760385	MAG	Israel	Asia

• Gene Location: Start: 39531; End: 40115 Strand: +

Full Sequence      

MRRRFKLKAFIILVAVFALGILLPLILHASTVDNARTVKVSYTQKGFIENLAPTAQKMSK
NYGVLASILLSQAAYESNYGSSLLSVKYHNIYSLPARPGQEHIYLKDNVYSKGKWQYQKV
DFAVFRDWSSSMSSYLEELRQGRWGESTYKEVAGTTSYKVAAEKLQAAGFNSDPDYTKHL
ISIIETYNLVKYDR

Enzyme Prediction     

No EC number prediction in MGYG000004345_01457.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	52	189	2.1e-24	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	6.63e-42	1	194	1	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	3.67e-21	38	190	2	142	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK06347	PRK06347	1.48e-14	43	193	149	303	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	1.51e-14	47	193	323	472	amidase domain-containing protein.
pfam01832	Glucosaminidase	1.46e-13	52	135	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD0166538.1	6.50e-135	1	194	1	194
ALD17871.1	6.50e-135	1	194	1	194
CAD0153805.1	6.50e-135	1	194	1	194
CAD0179136.1	6.50e-135	1	194	1	194
AQW33905.1	6.50e-135	1	194	1	194

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.93e-13	44	193	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	2.12e-06	45	185	4	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	2.34e-06	47	193	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN4_A	2.55e-06	45	185	4	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	4.04e-06	45	184	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.39e-21	4	193	3	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	9.25e-14	45	193	63	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	5.82e-13	43	193	61	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	1.07e-12	47	193	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P39046	1.04e-11	47	193	65	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.461324	0.535504	0.001071	0.000582	0.000519	0.000969

TMHMM  Annotations     

start	end
7	29