CAZyme Information: MGYG000004347_01556

Basic Information

• Species: UBA5884 sp900551505
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA5884; UBA5884 sp900551505
• CAZyme ID: MGYG000004347_01556
• CAZy Family: CE3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		35968.65	4.209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004347	1790191	MAG	Israel	Asia

• Gene Location: Start: 537; End: 1496 Strand: -

Full Sequence      

MNSADGGVYPEDNWEVVETVKGNTLHSRQHVIDMSGYNWIRINITGNDGKEGGHTSINMD
IHNVSDGINDSWIFYGDSITACGMMNCYGTGFAEYVNRIDDEYFPVQENGGIGGVRSSEG
AENIDRWLEDFPGKYVSIAYGTNDAWGNPSNTEQYYKNISYMVEKIIETGKTPIVPTIPY
STESAVGDNVPAYNARIEEIYKNYPEVIKGPDFYKFFSENPDLLSSDGVHPSEDGYASMR
QLWAETMYDEIYSKKENNTEVDGDVNEDGIFNINDISVFRKFLTGKDVLLKNQRAGDLNK
DNILNVFDLCKMKRILNNE

Enzyme Prediction     

No EC number prediction in MGYG000004347_01556.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	106	246	9.7e-21	0.7371134020618557

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01834	SGNH_hydrolase_like_2	4.05e-20	69	245	1	190	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
pfam13472	Lipase_GDSL_2	6.20e-20	74	237	1	175	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	2.01e-19	72	249	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
COG2755	TesA	4.48e-17	70	252	9	209	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
cd01822	Lysophospholipase_L1_like	1.39e-12	73	251	4	176	Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL17359.1	1.74e-147	1	319	122	437
ADU20874.1	1.25e-104	1	257	571	825
ADL52279.1	1.94e-87	2	283	137	416
BAV13051.1	1.94e-87	2	283	137	416
BBH92959.1	2.42e-28	2	247	324	575

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004347_01556.