CAZyme Information: MGYG000004348_00999

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004348_00999
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000004348_6|CGC1	36282.16	7.8485

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004348	1551350	MAG	Israel	Asia

• Gene Location: Start: 34730; End: 35707 Strand: -

Full Sequence      

MKKTLITLLTIICAMTANAANPYDNPDTLFVSRDGTGQFRTIGEAVEVCRAFMEYHKVIY
VKNGVYKEKLIIPSWLTNIEICGESADKTIITYDDHANIRLTGTNQPMGTFRTYTVKVEG
SDITFKNITIENNAAKLGQAVALHTEGDRLVFIGCRLLGNQDTVYTGVGNTRIYFKDCYI
EGTTDFIFGPSTAWFEGCTIHSKANSYVTAASTPKDVAYGYVFNNCTLTAATGVNKVFLG
RPWRPYAYTLFMNCTLGGHIVPQGWHNWKNPSNEQTARYLEYNNTGDGANTADRAPWSKQ
LTKKEAAKVTVENVFKQETNWIPTM

Enzyme Prediction     

No EC number prediction in MGYG000004348_00999.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	316	6.7e-103	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	5.60e-79	29	321	7	302	pectinesterase
pfam01095	Pectinesterase	5.07e-75	31	313	4	293	Pectinesterase.
PLN02682	PLN02682	3.31e-71	28	324	70	369	pectinesterase family protein
PLN02432	PLN02432	3.27e-65	31	307	15	278	putative pectinesterase
PLN02304	PLN02304	2.28e-64	22	307	68	360	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	7.43e-179	1	325	1	325
QVJ81978.1	4.48e-177	1	323	1	322
ADE82952.1	4.48e-177	1	323	1	322
AGB28242.1	8.93e-168	1	323	1	323
QJR97878.1	1.17e-164	23	323	16	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	3.23e-44	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.77e-43	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	2.48e-40	31	322	11	308	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	6.52e-40	31	322	7	304	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	7.41e-31	32	325	12	341	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.26e-57	31	306	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	5.96e-56	28	322	272	573	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
O23038	9.89e-55	24	322	86	388	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2
Q8VYZ3	4.26e-54	33	322	90	381	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q42608	9.87e-54	28	322	259	560	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000246	0.999041	0.000207	0.000164	0.000157	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004348_00999.