CAZyme Information: MGYG000004350_01283

Basic Information

• Species: CAG-245 sp900761475
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-245; CAG-245 sp900761475
• CAZyme ID: MGYG000004350_01283
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000004350_32|CGC2	39202.98	4.8813

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004350	1610653	MAG	Israel	Asia

• Gene Location: Start: 14987; End: 15994 Strand: -

Full Sequence      

MEKKKIALIIDTEGWAFDNIAHQLKNNLTEFDIDIIPGRIFEGNMIKLFLFGEDYDLIHF
LWRGYLTLIDRAEMHNYIEALGMSFEKFKQKYILNKNITFSVCDELYLSGDDEWRTEETM
KYGKEYFVTSKRLYNIYQQFSKKPQMVIHDGVDLQKYIPENLDRFKNIETVRIGWTGNSK
FKDSEGDSDMKGVEGIIKPAIEELQREGYSVELNLADRNIKMIPQEEMPKFYNSIDLYVC
ASKTEGTPLPIIEAMAMGVPVISTDVGIVSEAVGECNKKYILKERTKEDLKNAIKSIIKN
KQDFEEISKENIEKVKQWDWKVIAQQYKEFFESNM

Enzyme Prediction     

No EC number prediction in MGYG000004350_01283.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	218	306	6.5e-18	0.55

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0438	RfaB	3.59e-28	31	333	60	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340831	cd03801	1.03e-23	46	332	74	366	GT4_PimA-like phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam13692	Glyco_trans_1_4	7.32e-18	191	300	15	138	Glycosyl transferases group 1.
cd03800	GT4_sucrose_synthase	4.40e-17	133	327	178	396	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.
pfam00534	Glycos_transf_1	5.90e-17	190	314	14	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHD02568.1	2.04e-88	2	333	339	673
QHF35051.1	2.04e-88	2	333	339	673
ATX19549.1	1.21e-80	1	332	343	678
QER59987.1	1.21e-80	1	332	343	678
QHW84463.1	1.21e-80	1	332	343	678

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9N2	5.30e-06	215	273	227	285	Lipopolysaccharide core biosynthesis mannosyltransferase LpsB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=lpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004350_01283.