CAZyme Information: MGYG000004354_01640

Basic Information

• Species: Alistipes sp900548155
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900548155
• CAZyme ID: MGYG000004354_01640
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287		32358.5	8.4759

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004354	1972014	MAG	Israel	Asia

• Gene Location: Start: 1240; End: 2103 Strand: -

Full Sequence      

MFLDTADEHNGLKGLFRFARQVKKRGIDAVADTHFVLRSIVMTSYLFLSGLRFAFIRKGK
LEKWFRLGYSSPDAVPLKHTVVRYCDVFRRLGFVFDDPAPIADKPVRPNPFGEKNGRWIG
FAPFSAHAGKTYPADMSREAVALLAERYERVFIHGGGGAEQEFAVEMERRYPNVTALFGK
LKFAQEIDLISHLDCVVSMDSLVMHLCSLMATPVVSIWGATHPELGFLGYGCDPKGVLQQ
EMECRPCSTYGNKPCKWGDVRCIRAITPQMIADKVEYMMDKNRSAES

Enzyme Prediction     

No EC number prediction in MGYG000004354_01640.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	17	256	3.1e-36	0.9511111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.66e-27	9	276	61	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	9.75e-16	16	224	2	215	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	3.10e-05	157	221	223	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL13855.1	2.13e-129	4	287	58	339
BBL04346.1	2.13e-129	4	287	58	339
BBL09491.1	6.03e-127	1	279	43	320
BBL01632.1	2.44e-126	1	281	43	322
AFL77232.1	7.66e-125	3	281	64	341

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999946	0.000038	0.000001	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
34	56