CAZyme Information: MGYG000004358_01551

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004358_01551
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
182		20587.15	8.2481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004358	1997132	MAG	Israel	Asia

• Gene Location: Start: 3; End: 551 Strand: +

Full Sequence      

MIEGFSLFVVICFYRAMCRPFVKTFPVLSEGFQIETELSIHAVDHRWRIKDVPIEYRDRP
EGSESKLNTVSDGIKVVAMIGTLFKDYRPLKFFSLVALLFAVIGLALGMPIVVEYFQTGL
VPRFPTAMLAASFMFLCGLSLATGFILDSVAKVEKKQWEVNVYSKYAYDNQPGHPTSKPS
ER

Enzyme Prediction     

No EC number prediction in MGYG000004358_01551.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06442	DPM1_like	0.004	26	68	169	210	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH69465.1	4.74e-115	2	182	143	323
ATP53713.1	7.38e-112	2	182	143	323
QIA33395.1	2.23e-108	2	181	143	322
ACV54817.1	7.13e-81	2	169	147	314
ACV55215.1	4.28e-58	2	166	152	316

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37787	5.80e-37	14	149	5	140	Uncharacterized protein SF2094/S2216 OS=Shigella flexneri OX=623 GN=SF2094 PE=4 SV=1
D4GYG3	2.45e-07	14	157	153	295	Glycosyltransferase AglJ OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.986768	0.012860	0.000313	0.000024	0.000013	0.000030

TMHMM  Annotations     

start	end
92	114
124	146