CAZyme Information: MGYG000004361_01173

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; UBA3637
• CAZyme ID: MGYG000004361_01173
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261		30520.33	10.0847

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004361	1437740	MAG	Israel	Asia

• Gene Location: Start: 5523; End: 6308 Strand: +

Full Sequence      

MKLSVYIVTLNEAERLPRTIKAALQVADDIVVVDSGSSDGTVEIAEQLGARVIFHAWKNI
SSQKQFAQTQCRYDWVLSLDADEVLSPDLIKEINRVKEEPRHQAYKVRIGDMFPGFKRPR
RLAKKYNLVRLYDRRLSSMPDDLTHDRVRVGETVSVGQLKGLVHHYSYLTLHQTWVKYNL
YTDELVKTALVKGKKYSRLRLVTEFPRQFFIYYIVRRQIFNGLWGLVMATTLAYFRFLKI
AKYFEAKQGLTFRDNTLDEFV

Enzyme Prediction     

No EC number prediction in MGYG000004361_01173.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	114	1.2e-19	0.7058823529411765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	7.07e-70	2	229	1	229	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	4.11e-18	4	148	1	153	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02522	GT_2_like_a	1.06e-16	3	128	1	127	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	1.79e-16	1	251	3	259	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd00761	Glyco_tranf_GTA_type	6.11e-13	5	101	1	106	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCB18812.1	1.49e-63	3	247	4	250
QEL25842.1	8.44e-63	3	247	4	250
AZO76258.1	1.99e-62	1	255	2	259
QEN90867.1	4.37e-62	3	248	16	263
AOG07295.1	6.97e-62	3	247	4	250

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1RJ60	9.61e-44	2	242	8	258	Uncharacterized glycosyltransferase RBE_0523 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0523 PE=3 SV=1
Q4UMM0	2.85e-43	2	246	3	257	Uncharacterized glycosyltransferase RF_0337 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0337 PE=3 SV=1
O05944	5.05e-43	2	242	3	253	Uncharacterized glycosyltransferase RP128 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP218 PE=3 SV=1
Q68XF1	5.05e-43	2	242	3	253	Uncharacterized glycosyltransferase RT0209 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0209 PE=3 SV=1
Q92IX8	6.06e-42	2	246	8	262	Uncharacterized glycosyltransferase RC0292 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0292 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
219	238