CAZyme Information: MGYG000004362_01269

Basic Information

• Species: UBA10281 sp900767885
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp900767885
• CAZyme ID: MGYG000004362_01269
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712		80885.19	7.2231

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004362	1967499	MAG	Israel	Asia

• Gene Location: Start: 25233; End: 27371 Strand: +

Full Sequence      

MWVKRSKIAENGGLPLFIKKFGLKKELGRAELAITATGIFSVKINGKVIPDLFMPGWTNY
KKYINLCVYDITDYLAASNEIEVTVADGWYKGRLGCCKKINFYGKELRLFAEIKLCYKDG
ETQAIETDENWLTGVSDVVSADFFDGETIDARRLKNSENIGYKAIKTKFSAKLEKYSYEA
VRVKETILPKVIFDNGETIRYDFGKNFAGNIRFKACGKEGDTIIMKYAEVLNPDGSLYTE
NLRSAKSTDQLILSDGEYTFDPRFTYHGFRFAEITKSKTAMISDLKGLVVTQDIDYYGDF
ECSDKVINGVYAMVKNGQKSNFVGIPTDCPQRDERLGWTGDAQVFCNTAMFNADCDKFLR
NYLKLIRTDIPADGRIPSFAPLHFPVSRISTGVPGWAESIAVIPYFHYLHYRDKDVIKEN
IGAAEGWVRYYIEHSENYVVNVHNQFGDWLSVDNTTDKKVINQCLFGYSALLLSKMYKIT
GDEVNERKYAQVYQNAKEAFIRRYYKNGIVQSDTQTAYALAYTVGFLSVEETKKRLPELI
RTRGCLTTGFIGVRFILPTLCDIGETDLAYELMARTDYPSWGYMLANGATTVWERWNGYT
EENGFEDPGMNSFNHYSLGSCVEWLYSYVLGIKLSEDSQTVIIRPSISDKISYAKGRTRV
CGGMISVSWQRNEKTVTLEVKADKGVKYSVDTDRFKILSCEKIDNDTKLIIG

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	196	690	1.1e-149	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.79e-107	298	629	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.16e-32	25	153	1	132	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.03e-28	196	290	6	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.002	639	681	10	52	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEC78495.1	5.56e-152	2	680	158	864
BBE17666.1	1.41e-147	3	680	139	836
QIA08656.1	2.37e-144	20	670	169	844
QNF26773.1	2.93e-144	19	690	149	863
AMR33636.1	5.65e-143	15	690	152	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.83e-125	25	671	314	973	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	8.19e-98	15	680	177	886	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	4.29e-91	17	669	134	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.51e-125	15	706	174	891	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	7.64e-125	25	671	314	973	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	2.63e-112	15	669	170	855	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	3.29e-57	17	680	187	896	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000089	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004362_01269.