CAZyme Information: MGYG000004365_00374

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000004365_00374
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		47488.15	8.2702

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004365	2654246	MAG	Israel	Asia

• Gene Location: Start: 4215; End: 5468 Strand: +

Full Sequence      

MKYRSIISLIIALSLGTLQGACQQNRQDSCGRFDSYKGLVMAGYQGWFNTPGDGANRNWH
HYENGRVFRPGACTIDLWPEVSEYPQLYPTEFTFENGDTARVFSSYDASTVDTHFRWMQD
YGLDGVFMQRFISEIRNNSGRKHFNKVLESALASAAKYERAIVVMYDLSGMNAGDGALLL
KDMKDLCKRFDLQNRKKNPTYLHHNGKPLVTVWGVGFNDRRRYGLEDAKMIVDGLKEMGF
SVMLGVPTYWRTFGRDTEKNPELHALIKKCDIVMPWFVGRYNDKSYRQFAPLIAGDIAWA
KANGVDYAPLCFPGFSWKNMNGHENSVPIPRNKGNFFWQQLSNCINSGAEMLYIAMFDEI
DEGTAIFKCAKRVPVGASRFVPIEDGIESDHYLWLAGQAGKMLRGEIPLQMQQPVRQ

Enzyme Prediction     

No EC number prediction in MGYG000004365_00374.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH43	98	364	6e-27	0.9597069597069597

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11576	GH99_GH71_like_2	0.0	34	406	1	378	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism. The domain may co-occur with other domains involved in the binding/processing of glycans.
cd11573	GH99_GH71_like	6.11e-34	106	399	8	282	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
cd11575	GH99_GH71_like_3	8.39e-07	39	366	8	307	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.
cd11578	GH99_GH71_like_1	5.71e-06	103	366	28	290	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU96999.1	1.27e-199	32	406	26	400
BCA51193.1	2.76e-198	32	406	8	382
QUT39634.1	4.97e-198	32	406	26	400
QUT72097.1	4.97e-198	32	406	26	400
AAO76888.1	2.24e-197	32	406	8	382

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000020	0.015662	0.984336	0.000005	0.000007	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004365_00374.