CAZyme Information: MGYG000004365_00385

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000004365_00385
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820		90829.86	6.6884

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004365	2654246	MAG	Israel	Asia

• Gene Location: Start: 26971; End: 29433 Strand: +

Full Sequence      

MKKIYLSLLLAVFALVVQANELKLKYSHPAKVWVEALPVGCSNMAAMVYGGVSDEQIQLN
EETMWGGSPHDNNNPAGREALDEIRAKIFAGDLKGASDLCQKSMFSGKNGMPYQTVGSLH
IKTPDRGEVSGYTRDLDLNRAVATTRYTVGGVTYTREVFASLADRVIIVRITADKPGMVD
FDLAYTSPLPGHKVSRRGKSLVLKGNGMDHEGVPGVIKMETQTRVAAEGGRTVLNDSTLS
VKGADAATIFIGSATNFVNYKDVSGNATKKATAMLDRVVKQPYSQLLANHEAKYKEQFDR
VSLDLGSSPLENLDTPERIARFNEGKDMPLAALMFQFGRYLLISSSQPGGQPANLQGVWN
HQLQAPWDGKYTININTEMNYWPAEVTNLSETHEPLFSMVNDLSVTGAKTAREMYGCRGW
VTHHNTDIWRTCAPVDGPFYGNWPNGGAWLTTHVWQHYLYTGDKEFLAKYYPAIKGVADF
YMDFMIEHPTMGYLVTVPSMSPEHGPANENDQSGSSLTAGCTMDNQIVFDALTSARRASE
ILGEPQSYRDSLTAVLDRMAPMQVGRHNQLQEWLGDYDDPNDKHRHISHAYGLFPGMQIS
PYRNPELFQAMRNTMIQRGDEATGWSIGWKINLWARLQDGNHAFKIINNLLKILPDDRQT
SKYPVGRTYPNMFDAHPPFQIDGNFGYTAGVAEMLMQSHDGAVHLLPALPDAWQEGSVKG
LVARGGFVTDIDWKAGQLASAKVYSRLGGNLRIRSYIPLDIEGATEAKGENPNPLYKTEA
IKTPLISPEITPQHPILNRVYEYDLPTEAGKSYAVKPAKF

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	19	755	3.6e-292	0.981994459833795

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	1.70e-79	24	259	1	233	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
COG1554	ATH1	1.86e-05	124	483	98	473	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam17389	Bac_rhamnosid6H	3.57e-04	378	488	40	137	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam03636	Glyco_hydro_65N	0.002	124	181	85	151	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT84104.1	0.0	3	816	2	816
AND20554.1	0.0	13	816	14	816
AII63105.1	0.0	13	816	14	816
ALA74841.1	0.0	13	816	14	816
QJR60123.1	0.0	13	816	14	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UFC_A	0.0	17	815	17	804	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
7KMQ_A	6.16e-210	16	753	35	757	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2RDY_A	4.25e-185	21	770	2	770	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
2EAB_A	2.38e-93	37	754	52	850	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	1.70e-92	37	754	52	850	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	2.06e-167	19	745	49	804	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	4.25e-94	36	733	38	756	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	7.57e-83	39	754	46	797	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	3.47e-62	7	753	3	714	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000230	0.999120	0.000195	0.000147	0.000149	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004365_00385.