CAZyme Information: MGYG000004365_00468

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000004365_00468
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1144		129357.89	6.0806

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004365	2654246	MAG	Israel	Asia

• Gene Location: Start: 19063; End: 22497 Strand: +

Full Sequence      

MRLNLLSLRSLTVCLLLMVSASVWGKSSAAGRFSESLDGDWHLYVDKNAQWENDTLYLPS
EVPPMAQLPLNPPTGGWNVLTQSSIPVTVPGSVEQFCTKKVQPSPDDSKGVSWWWRTFSV
PADQKGKRVILHFQSVRMRAEVFVDRQLVGYDIIGETPFSCDITDAIKWGQEQTLAVRVT
NPGGNFHWQDYVPMNWGKYQLPPSRGFSGIIGNVTLQCVPEDMHIDDLYVLNTPDLKKVK
VHASLVSAAGKKKDARMQILVRRGDKVLFDKTFDRVKWHGDTANVVYDVECPDAEIWDLD
NPNLYLCEARLLQDKKMVDNTGRKFGFRWFAPEGVGEDAILTLNGKRIVLRSAISWGYYP
MTGLTATKEISDRQVKVARALGQNMMNFHRCIGQPEMLNSADSLGLLMFEEPGSFQAGKT
PFAMALIEEKVKRMVRRDRSHPSLVIYNMMNEYNSRDDVWDQNRLALMRNLHNEYDPSRT
MTFASAWAGAKDIDQKQKANLLPYETELRMHGWWDNHRAGGEATYIEGYYKSPADNYMFS
DNLREIYMRGEEGAISTPPRLELIQRDIAGRQGWDSRFWEEQYKAFLVYFRENNLWPYFH
SIDSLTSMMGRVQLDHQGRRIMSMRMQNIGDIYVVNGWESMPYDNHSGIVDIWRYPKSDP
AVMAYYNQPLYIAVMPRQQVAHVDDKVLVDFYIINEKDIKGDFNMEISLRKSGETAPVAG
FRPITKRVHLTGGNRYGELLAEAVEIVMPKDGAMYEIVASIPGASQEIKGRDQLLVVDWN
KDELLKGNGAIYGESQDQVAQFYEKATGKPLPAFSSDTKNLDWLIVDRSSFDEPELIPAS
AFADPDGNGKPVTVTWFTDNDIHDKAGESKIDRVDVSFASGAQPAPCLPANQVFSATYDM
DIMPQKTGLYQIGVEATAGVRLYINGEQKLDAYWNKEPYKNSTPVYMEEGKPVHVRVGYY
QHTPSGSVKLLWSTPGSQRVSPQEILDRAKNDGTTVVVLGKTETWMSHMAQAVNDSKLNP
TAVKINKIYTVGKNWVGGLHFVKDHPLFDGLPVNCAMDWPYQAVVEDGDNRFSFDMEGAE
LVVGSYRSWPFYLGTAVGVIPYGKGQIIFSTLNIPDQLNSDAPSADVARRILLNYLNYKP
TSVR

Enzyme Prediction     

No EC number prediction in MGYG000004365_00468.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	30	603	2.1e-73	0.5930851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.92e-34	35	483	13	431	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	2.00e-17	77	485	35	449	beta-D-glucuronidase; Provisional
smart00758	PA14	5.89e-16	852	976	3	127	domain in bacterial beta-glucosidases other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins.
pfam07691	PA14	3.11e-15	849	985	1	140	PA14 domain. This domain forms an insert in bacterial beta-glucosidases and is found in other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins, including anthrax protective antigen (PA). The domain also occurs in a Dictyostelium prespore-cell-inducing factor Psi and in fibrocystin, the mammalian protein whose mutation leads to polycystic kidney and hepatic disease. The crystal structure of PA shows that this domain (named PA14 after its location in the PA20 pro-peptide) has a beta-barrel structure. The PA14 domain sequence suggests a binding function, rather than a catalytic role. The PA14 domain distribution is compatible with carbohydrate binding.
PRK10340	ebgA	2.09e-13	116	452	115	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68997.1	0.0	23	1138	14	1127
QUT88121.1	0.0	31	1138	24	1129
ALJ60861.1	0.0	31	1138	24	1129
QRQ50392.1	0.0	39	1138	21	1117
QUT46481.1	0.0	39	1138	33	1129

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	6.48e-27	110	536	71	496	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	1.14e-26	110	536	71	496	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	2.14e-26	110	508	64	454	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	2.54e-25	110	509	70	461	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6ED1_A	6.52e-25	109	498	76	467	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	2.74e-28	8	494	27	479	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	1.19e-24	106	574	52	496	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P26257	3.41e-21	125	479	69	411	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
P24131	5.99e-21	118	511	129	512	Beta-galactosidase OS=Clostridium acetobutylicum OX=1488 GN=cbgA PE=2 SV=2
T2KN75	7.58e-20	109	447	86	433	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000224	0.999175	0.000159	0.000158	0.000140	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004365_00468.