CAZyme Information: MGYG000004365_00685

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000004365_00685
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000004365_14|CGC1	75083.62	4.8148

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004365	2654246	MAG	Israel	Asia

• Gene Location: Start: 44183; End: 46210 Strand: +

Full Sequence      

MKKQLIFILAGLLAVGSASARNGNDVAVETVDRPAMATAAADLRPLALEKLPLGAIKPEG
WLKKQLELQRDGLNGHLSEISAWLDKSNNAWLVPGASNGWEESPYWLRGYSRLGYILGDS
AMIAEAKSWFDPIIASQRADGFLGPENMKNGHPEIWAQMLMLDCLQGYYEYSRDPRVLDL
MRRFFQWEMSLPDEDFLEDYWENCRGGDNIWSVIWYYGQTGDKSVLPLIEKIHRNNADCT
NPAALPNWHNVNIAQYFREPAEVSLLTGDSTLMTATYNVYDLIRRTYGQAPGGMFGADEN
ARIGYIDPRQGTETCGFAEQMASDGIMLSVNADPFWAENLEDIAFNSFPASMTDDLKALR
YLTAPNHAISDSKNHNPSVDNSGPFFNMNPFSSRCCQHNHGLGWPAFTQSLAYATPDGGV
AFPVYAPCQATFNVADGKSATVSEDTQYPFSDTLRFTVSSKSSEEYPMYFRIPVWAKGAT
AKVNGKKINCNPEGGKYLKIDRKWADGDCVELVFPMELSVRRWAVNRNSASVNYGPLTLS
LKIVERYNKVDSKESAIGDSHWIEGADTEKWPTYEIFPESPWNYSLILPADNSTAGFEVV
KLPWPADNQPFRLSGVPLEVKAKGRLVPSWGFDSTGLTGVLPREDAPRAAQVDEITLVPM
GAARLRISAFPTSEK

Enzyme Prediction     

No EC number prediction in MGYG000004365_00685.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	251	537	1.4e-28	0.5438931297709924

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	5.41e-91	105	540	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.08e-18	99	541	57	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKW41448.1	1.35e-164	40	673	48	667
QNQ38172.1	2.70e-164	40	673	48	667
QTA30297.1	1.51e-163	40	673	48	667
AGK75525.1	1.51e-163	40	673	48	667
QYA92533.1	2.13e-163	40	673	48	667

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.95e-16	249	606	265	632	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	6.71e-15	313	552	381	621	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	4.38e-14	249	606	265	632	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.34e-10	249	516	247	517	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000388	0.998882	0.000197	0.000182	0.000160	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004365_00685.