CAZyme Information: MGYG000004365_01046

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000004365_01046
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		36689.09	7.8288

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004365	2654246	MAG	Israel	Asia

• Gene Location: Start: 3031; End: 4017 Strand: +

Full Sequence      

MQNSLKPLVSILMPVYNGAKFMGQTIENLLKSSYDNIEIIIVDDGSTDDSFKIASRYSQS
NSKVKVFQQENAGAGAARNRAFHESAGEYCMYMDCDDLISPNKISRQVECLREEDASAIA
SCAWVEFTDILPSSSYPLKIHKDYLSPLNLETEMLNSGEYMQTSCWMVPRHLIESSGGWN
SRLSINDDGAFFAKILSIASKVIFCGGEIVYYRRGHESLSTSDIYAERKLRALLDSYEEI
QKILLTVGANHSNLLPEIRCGLARNYALVMCKAPYHSAVYNEAKAMIRALGLSPKHPHPT
SRAALISNIIGLNKFLKLRSLCQKMKSR

Enzyme Prediction     

No EC number prediction in MGYG000004365_01046.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	10	126	2.6e-31	0.6941176470588235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	3.07e-27	11	125	1	116	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	1.56e-24	10	119	1	111	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
PRK10073	PRK10073	6.67e-21	1	122	1	120	putative glycosyl transferase; Provisional
COG0463	WcaA	1.27e-19	6	271	2	248	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd02525	Succinoglycan_BP_ExoA	2.42e-18	8	214	1	209	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ36298.1	3.51e-112	7	321	7	319
QCY55391.1	2.38e-111	1	320	1	319
QRO15895.1	3.22e-57	7	324	4	317
ABR43944.1	3.22e-57	7	324	4	317
BCI64598.1	1.31e-56	7	321	5	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.86e-20	8	248	6	249	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	9.69e-16	4	99	2	97	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
2Z87_A	9.14e-15	7	114	374	481	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
2Z86_A	9.15e-15	7	114	375	482	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
1H7L_A	4.23e-08	7	119	1	121	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q68X33	2.73e-26	2	254	3	254	Uncharacterized glycosyltransferase RT0329 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0329 PE=3 SV=1
Q9ZDI9	2.59e-24	2	243	3	230	Uncharacterized glycosyltransferase RP339 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP339 PE=3 SV=1
A0A0H2UR96	1.36e-23	5	223	1	225	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q4UM29	1.63e-21	7	199	14	205	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
A0A0H2URH7	1.97e-20	9	327	7	330	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004365_01046.