CAZyme Information: MGYG000004365_01273

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000004365_01273
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
794	MGYG000004365_35|CGC1	88922.59	5.9543

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004365	2654246	MAG	Israel	Asia

• Gene Location: Start: 13755; End: 16139 Strand: -

Full Sequence      

MNKLIERFLALATGVAAMAAVVAAAPDAAAQSKLYPNEFDLKEVELLPSKFSHAMELNVE
VLLKYDTDRLLAPYLKAAGLEPKAESFSCWDGLDGHVGGHYLSALAISYAATGNPELKKR
MDYMLDELERCQKASGNGYVGGVPDGKRLWEGIRNGDVGLIWKYWVPWYNVHKIYAGLRD
AWLYGGSKKARKMFLKMCDWGVDEISTLSDEQMESMLGNEFGGMDEVFADAYAMTGDRKY
LDAARRFSHHWLLDSMAAGVDNLDNKHANTQVPKVVGYQRIAELADDPVYYDAARFFWNT
VVNDRSLSLGGNSRREHFAPAADCRSYVTDREGPESCNTNNMLKLTEGLFRMEPKAEYAD
FFERAMMNHILSTQHPDHGGYVYFTPARPAHYRVYSQPNAAMWCCVGTGMENHGKYGQFI
YTHTGDSLFVNLFVPSRLNWKEKGITLTQTTAFPSTDSSRLKIGLGKGKSKKFDLLVRYP
GWCSGMTVKVNGTPADVTARPQSYISIDRTWHDGDVVELKMPMTLRFEALPNVPEYLSVM
YGPVLLSARYGTDGCYGLVADDSRWAHIAHGPLVSVFDTPVLIGSKDELQAQLAKLQRID
GKPLSFRADDAFGGLTLEPFYNIHDCRYIMYWLTMTPEEFAAHEAQEKAAEEARLALDRR
TVDAVNAGEQQPEADHFMEFDRSQTGNREGQSWRSAADGGSFSYRLKTAAAPLQLMIRYW
GNEPAGHDFDILIDGELLASENLSGKWKTDTFEEVTYDIPANFLAGKDHIRVTFRSRPST
TAGPVHSLRLLLPE

Enzyme Prediction     

No EC number prediction in MGYG000004365_01273.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	43	546	9.6e-202	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	5.28e-177	43	547	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.15e-116	41	554	9	508	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	2.70e-33	551	632	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36520.1	0.0	11	794	7	788
ADY37333.1	0.0	30	791	20	795
QCD43163.1	0.0	27	791	16	784
SCV06553.1	0.0	30	791	23	796
QRQ58640.1	0.0	30	791	23	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.54e-224	30	791	19	801	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.85e-217	30	791	19	801	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	2.54e-21	101	533	82	543	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.36e-20	83	550	61	548	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	9.55e-20	101	533	82	543	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000615	0.998506	0.000214	0.000247	0.000205	0.000185

TMHMM  Annotations     

start	end
7	29