CAZyme Information: MGYG000004371_00958

Basic Information

• Species: Prevotella sp002251385
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251385
• CAZyme ID: MGYG000004371_00958
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776		83835.92	6.665

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004371	2690194	MAG	Israel	Asia

• Gene Location: Start: 22269; End: 24599 Strand: +

Full Sequence      

MKRMIMTAAIVCMAGIQMMAQPKLPYRNASLPIEERVSDLLSRMTLEEKVGQLRCTLAWN
YYDIKGNKVVPSSTFMKDIAEGNIGMLWATYRACPWTRKSLATGLTPTLAAKAGNALQRY
VIEHTRLGIPLFLAEEAPHGHMAIGTTVFPTGLGMAATWSTATAEAAARVTAKEVRLQGA
HISYGPVLDISRDPRWSRVEESYGEDPVLTGEMGAAIVRGLGGGKLSAPYATLATLKHFI
AYGTTEGGQNGNPSIVGERDLLQTFFPPFKKAVDAGALSVMTSYNSLDGIPSTASGELYN
DILRRQWGFRGFVVSDLYSIDGIWETHHVARDLQEAGVMALRAGVDEDLGGKAYAQLIAA
VKDGKLSEKEIDQACGRILRLKFEMGLFEHPYVDVKAAAEVGCADNAAVALDAARKLVTL
LKNKDNTLPLRRDMRVAVVGPNADNVYNMLGDYTSPQPDGKVKTVLAGIKAKLGEGQVEY
VKGCAVRDTNNCNIEAAVEAARRADVVVAVVGGSSARDFKTSYKATGAAEADVKSVSDMD
CGEGYDRATLSLLGRQMELLQSLRKTGKPMVVIYIEGRPMDKSWAAANADALLTAYYPGQ
EGGTAVADVLFGDYNPAGRLPISVAANVGQLPVYYNKRAPKPHNYVEMSAAPLYAFGYGL
SYTQFAYSNLAIAKKGDAYSVTFDIKNVGERDGEEVAQLYIHDQVASVSQPLLQLKKFDR
LSIAKGETRKVEFVLTAEDLAIIDRNMKSVVEPGDFDIMVGGSSDNLPLRGVLTVE

Enzyme Prediction     

No EC number prediction in MGYG000004371_00958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	123	346	2.3e-69	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	761	1	751	beta-glucosidase BglX.
COG1472	BglX	2.69e-91	44	476	1	390	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.00e-81	25	761	41	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.17e-71	45	381	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	2.00e-57	418	662	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYR10513.1	0.0	1	776	1	779
QVJ80985.1	0.0	1	774	1	780
ADE83756.1	0.0	1	774	1	780
VEH14396.1	0.0	25	776	32	784
ALO48411.1	0.0	20	776	29	787

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	3.57e-138	26	767	7	748	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5Z87_A	1.22e-137	26	767	36	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
7EAP_A	1.40e-137	26	767	7	748	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5I_A	1.74e-136	34	761	4	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	9.57e-136	34	761	4	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	4.99e-138	12	764	5	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.75e-137	12	764	5	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	2.07e-122	126	776	62	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.24e-112	26	764	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.93e-93	2	761	5	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000419	0.998839	0.000247	0.000165	0.000150	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004371_00958.