CAZyme Information: MGYG000004371_01254

Basic Information

• Species: Prevotella sp002251385
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251385
• CAZyme ID: MGYG000004371_01254
• CAZy Family: GH143
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596	MGYG000004371_28|CGC1	67385.85	7.0739

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004371	2690194	MAG	Israel	Asia

• Gene Location: Start: 5586; End: 7376 Strand: -

Full Sequence      

MRQFFIPLFALMTTTASAQTGSEREPVSYIGGEICNPRLHDGGLAYAIGAENVQVMRANR
THPDEADGYGWTYNHAANITYWHGKFYLEYLSNPVDEQQPPGQTLLVTSDDGRHWSKPFV
AFPPYQAPKGVTIPKPYYGYIMHQRMGFYTAPNGRLLVVAFYGHSYNPFKEGGIGRVARE
IKADGTMGPIYFIRYSSHAQWNETNTAYPFYTKSKDKGFREACQALLGDKLKTLQWIDED
RGLDGFYNLKDSINRVQATSYYHRKDGKTVALWKWSYAALSPDDGKTWSTPVRIPSLIMA
GGKQWGQRTPDGRYAICYNPIETQPYRYPLIAISSDDGITYDSMCVVHGEVPPRRFMGEN
KDFGPCYVRGITEGEATPPGNDMWLAYTVNKEDVWVARVPTPIRTKWTGKVDDNFDNIKP
HGAVTDWNIYRPRWADVYVNDSHQLCLTDSDRYDYARAIRVFEAKAKTDISLDVQVAAEN
DDPFEVDVTDRHGVRIVCVSLHGGKVVANGETVGSYKQGKWLSLNIRIVDGGVEVQGHKL
LAMHSAQHPERLSLRTGEYRDLPNRNTPNQEKCPPLPGCDERIAPAMYIIDNVRVD

Enzyme Prediction     

No EC number prediction in MGYG000004371_01254.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH143	19	528	7e-200	0.935251798561151

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	2.36e-05	264	342	170	252	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	3.28e-04	260	338	95	182	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd08989	GH43_XYL-like	0.009	61	118	52	113	Glycosyl hydrolase family 43, beta-D-xylosidases and arabinofuranosidases. This glycosyl hydrolase family 43 (GH43) subgroup includes mostly enzymes that have been annotated as having beta-1,4-xylosidase (beta-D-xylosidase;xylan 1,4-beta-xylosidase; EC 3.2.1.37) activity, including Selenomonas ruminantium beta-D-xylosidase SXA. These are part of an array of hemicellulases that are involved in the final breakdown of plant cell-wall whereby they degrade xylan. They hydrolyze beta-1,4 glycosidic bonds between two xylose units in short xylooligosaccharides. It also includes various GH43 family GH43 arabinofuranosidases (EC 3.2.1.55) including Humicola insolens alpha-L-arabinofuranosidase AXHd3, Bacteroides ovatus alpha-L-arabinofuranosidase (BoGH43, XynB), and the bifunctional Phanerochaete chrysosporium xylosidase/arabinofuranosidase (Xyl;PcXyl). GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYQ36507.1	1.43e-253	15	595	18	624
AEI49119.1	1.59e-252	18	595	21	623
QJD77140.1	1.48e-250	4	595	5	613
QKZ12138.1	3.46e-249	1	595	1	622
AXE18473.1	4.91e-249	18	595	21	623

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQS_A	4.66e-129	18	594	21	608	SialidaseBT_1020 [Bacteroides thetaiotaomicron]
5MQR_A	7.18e-127	18	594	21	608	SialidaseBT_1020 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000236	0.999116	0.000165	0.000154	0.000142	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004371_01254.