CAZyme Information: MGYG000004377_00757

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004377_00757
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		43492.61	10.3527

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004377	2011786	MAG	Israel	Asia

• Gene Location: Start: 4107; End: 5258 Strand: +

Full Sequence      

MKYMVIAGEASGDLHASRLIENIRTDDPEAEFRFFGGDLMTKAARRNPELHYREMNVMGF
SEVLRALPRLWRNMRQARALIRSWRPDVLVLVDYPGFNLALAGFAKKLGIPVHYFISPKV
WAWKEYRVRKIKKTVDRMYSILPFEEEFYARHGYKVDYVGNPSVEEIAWSMGHLPPKKHF
MERQGLGDERPIIALLPGSRKGEIRNNLPLMVEAAKRFPEFQYVVGAAPSVPEKFYREVA
QDPGLKVVFGCTHTLLKYSRAAVVVSGTATLETALIGTPQVVVYRANGSRLSYNIMARLL
KVRYVSLPNLIVNNSIVSELLLDRCTAASIARELSPLLQPSPRLTFQQQGYRNMQRRLGT
SVASEQAALLIVEQLKKGNQQGK

Enzyme Prediction     

No EC number prediction in MGYG000004377_00757.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	358	6e-116	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.12e-125	1	377	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.72e-120	1	377	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.02e-86	5	371	3	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.33e-79	5	373	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.16e-57	1	313	2	288	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	1.42e-128	1	375	1	374
QQR08529.1	8.38e-124	1	381	1	379
ASB37800.1	8.38e-124	1	381	1	379
ANU64105.1	8.38e-124	1	381	1	379
BCI64292.1	7.45e-120	1	377	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	9.38e-44	5	373	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.55e-43	5	373	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	3.04e-76	2	378	6	381	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	7.98e-70	4	379	7	382	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	9.06e-69	2	377	8	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
C1F718	7.77e-68	7	364	11	377	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q74AT9	6.08e-66	2	377	8	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004377_00757.