CAZyme Information: MGYG000004381_02373

Basic Information

• Species: Lachnospira sp900772425
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp900772425
• CAZyme ID: MGYG000004381_02373
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		44163.36	4.6995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004381	2725945	MAG	Israel	Asia

• Gene Location: Start: 7567; End: 8712 Strand: +

Full Sequence      

MDIIVKYIDELLDKSTPEAPMWNIEKIRQGLKSNWNYIDGVMIKAVLQMYDVTKDEKYLK
FADDFIDYRVHEDGTIEGYSIGEKNIDNVNAGKTLFELYDITGKEKYRKAIDLVYSQIEI
MPRCNNEARSFWHKDIYPNQVWLDGMYMGQPFYIEYETKFNNRKNYPDIFAQFKFVIENM
KNPLNGLYYHAIDVSREAFWCDKVTGLSQHCWLRASGWYAMALLDTLDKVDNSDHKYDAE
CKMLEDAFVELMNSMLKYQDESGMWYQVVNYGGMEKNYLETSGSSIMAYALLKGVRLGYL
PKEYKEYAKKAINGICDKYLKTKDGEMSLGGICLVAGLGGKGNRPGTYDYYMSEPIVEDD
AKGVGPFLLAYTEMLLDEDNK

Enzyme Prediction     

No EC number prediction in MGYG000004381_02373.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	31	375	5.3e-113	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.52e-88	31	376	30	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.30e-79	35	375	27	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
cd04792	LanM-like	0.002	33	111	586	676	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR71682.1	9.96e-237	1	379	1	380
ABX40590.1	2.92e-202	1	375	1	371
AEN96572.1	1.54e-200	1	374	1	370
VCV21981.1	2.78e-200	1	374	1	370
CBL09353.1	5.61e-200	1	374	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.03e-105	31	373	19	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.22e-62	33	374	37	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.39e-62	33	374	27	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.22e-61	33	374	37	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	4.50e-39	148	376	1	230	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.50e-39	148	376	1	230	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	4.44e-20	35	328	29	297	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004381_02373.