CAZyme Information: MGYG000004385_01705

Basic Information

• Species: Lachnospira sp900545725
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp900545725
• CAZyme ID: MGYG000004385_01705
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		35437.72	5.2219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004385	2735315	MAG	Israel	Asia

• Gene Location: Start: 28283; End: 29221 Strand: +

Full Sequence      

MITVAKDGTGDFTSVNEAIKSIPDGNETIFIKNGIYRERVEITVDNITLIGENNKETVIT
EGFYALMPMPDGSRRGTFRSYTFLVHADNFSAYNITFENSSGFGKDVGQAIAVYAEGDHI
IFKNCRMLGHQDTLFTGPLPLKEIQPGGFTGPTQFCERIPGRQLYEDCYICGEIDFIFGS
ATAYFKNCELYALNRNEKINSFYTAPSTYEGEKFGYVFEHCNFTGNCPDRTVMLTRPWRI
YSKVVFLNCSYSGQITETAFHDWNKPESHKTCYYAEYKCSGDGYVPDKRPDYVHQLTDEE
AKAYTRHNVIGF

Enzyme Prediction     

No EC number prediction in MGYG000004385_01705.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	2	310	2.5e-92	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	2.65e-72	1	309	83	401	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.43e-67	2	311	2	296	Pectinesterase.
PLN02773	PLN02773	1.60e-62	1	310	6	296	pectinesterase
PLN02665	PLN02665	4.53e-61	2	304	70	348	pectinesterase family protein
PLN02432	PLN02432	3.94e-59	1	311	12	287	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR72174.1	1.16e-159	1	311	1	312
SET76962.1	7.31e-115	1	311	1	314
ADZ82949.1	3.52e-113	4	311	3	313
QEH68466.1	1.42e-112	4	311	3	313
AGF58031.1	4.86e-108	1	311	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	5.73e-36	4	303	7	289	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	3.78e-34	12	311	18	335	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1GQ8_A	1.85e-31	2	289	9	278	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	4.19e-31	11	238	43	269	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1QJV_A	1.48e-28	12	311	18	335	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.66e-45	1	310	6	296	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8L7Q7	2.49e-40	2	310	289	592	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q8VYZ3	3.66e-40	6	304	90	369	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q1JPL7	1.98e-38	2	289	247	516	Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana OX=3702 GN=PME18 PE=1 SV=3
Q8GXA1	3.07e-38	4	305	260	546	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998912	0.000936	0.000101	0.000008	0.000004	0.000072

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004385_01705.