CAZyme Information: MGYG000004390_01735

Basic Information

• Species: Prevotella sp002265625
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002265625
• CAZyme ID: MGYG000004390_01735
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449	MGYG000004390_33|CGC1	51534.65	6.8733

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004390	3321071	MAG	Israel	Asia

• Gene Location: Start: 15759; End: 17108 Strand: -

Full Sequence      

MKLKQILCSLLCLAATSGAVAQDTTQVETEEQKDKRMEWFDHAKLGIFVHWGIYAVNGVS
ESWSFHNKYLPYEQYMSQCSGFTASKYDPKAWLDLIKESGARYTVITTKHHDGVALWNTK
YSDLNTVKATAAKRDLLTPFVKEVRKHGLKLGLYYSLIDWSHPDYPNFTRTETRYDVKDD
PARWQKFLKFDFDQLGELNAYKPDLYWFDGDWEQSAETWNAKGMSEFLRKANKNVIINSR
IQGYGDYATPEQGVPVVRPEDKHWELCMTMNDSWGYQHADTNYKSPYILLRTFVDCLSMG
GNMLLDIGPKEDGTIPEEQVAILKEFGRWTKKHKEAIYDTRAGIPCEHFQGYSTLNKAGD
ILYLYLPYKPNGPIEVKGLMNKVNRVWVVGDGEIISSKVFNKNYWSEVPGNLYINVPERS
LDPMITVVAVLLDGPIKLYRGAGKVIESN

Enzyme Prediction     

No EC number prediction in MGYG000004390_01735.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	20	339	1.5e-99	0.9277456647398844

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	3.48e-134	29	379	10	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	2.93e-123	21	335	1	333	Alpha-L-fucosidase.
COG3669	AfuC	2.56e-45	50	342	1	324	Alpha-L-fucosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEW35856.1	3.84e-273	13	449	14	449
ABR41654.1	5.45e-273	13	449	14	449
QUT57144.1	5.45e-273	13	449	14	449
QQY40065.1	5.45e-273	13	449	14	449
QJR73539.1	2.21e-272	13	449	14	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GN6_A	3.88e-81	33	433	27	444	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
2WVS_A	4.35e-54	31	420	17	428	Crystalstructure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_B Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_C Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482],2WVS_D Crystal structure of an alpha-L-fucosidase GH29 trapped covalent intermediate from Bacteroides thetaiotaomicron in complex with 2- fluoro-fucosyl fluoride using an E288Q mutant [Bacteroides thetaiotaomicron VPI-5482]
2WVV_B	5.07e-54	31	442	13	448	Crystalstructure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
1HL8_A	6.93e-54	38	412	22	434	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL8_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL9_A Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8],1HL9_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8]
1ODU_A	9.68e-54	38	412	22	434	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q99KR8	2.08e-46	29	340	31	364	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
P48300	3.12e-46	38	421	51	448	Tissue alpha-L-fucosidase OS=Canis lupus familiaris OX=9615 GN=FUCA1 PE=2 SV=1
Q2KIM0	3.30e-46	39	341	55	376	Tissue alpha-L-fucosidase OS=Bos taurus OX=9913 GN=FUCA1 PE=2 SV=1
C3YWU0	8.55e-46	39	341	33	356	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2
Q60HF8	1.23e-45	39	377	54	413	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.069682	0.921308	0.002945	0.003060	0.001471	0.001511

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004390_01735.