CAZyme Information: MGYG000004391_00083

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UBA7057
• CAZyme ID: MGYG000004391_00083
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
945		104820.02	9.279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004391	549473	MAG	Israel	Asia

• Gene Location: Start: 72697; End: 75534 Strand: +

Full Sequence      

MAKVKNKTATKKRTYSKKKNIKIEKPIIIIGLIVLALIILSYITFGLYMTIILTVGILLI
LGIARLLDKVKSKPKRRKILNIILIIFFIIAIAIILFIAAFFIKIVKEAPNFDITKLNKQ
EATILYDNKGEEFARIGTEMRENVTYDDLPEVFIDALIATEDSRYFQHNGFDAPRFIKAS
IGQVLGNKNAGGASTISMQLIKNTYTGNEAKGIDGIIRKFTDIYLAVFKLEKNFTKEEII
EYYVNNYDLSNNSLGVEIASKTLFDKSVRDLNLSEAALLVGIFNNPTAYNPFYNPNNAYK
RRQEVLGLMVKHGYITSEEANIANSIPVDSLLTKTAKTLEYQSYIDTVREELINKYGINP
TTTSLLVYTNMDRDKQKGLDDIFNSKTFTWPNNKVDSGVAVVENSTGKIIAVGSGRNKTG
AFQNNLATQAKRQIGSSAKPIFDYGPAIEYLGWNTYTQILDEPWTYSTGQSVTNSDSQYK
GWMSMKTALAQSRNVPAVKTFQQVSEQVGNKKIIEFAKNLGLTPQIENGQIYEAHALGAF
DGTTPLQMAAAYAAFGNGGTYHEPLSVNKIVYRENNTVKTFKGSETKAMSETTAYMITDM
LIEAVNTGLSGAAKMSGVTVAAKTGTTNFDSSTKRQYNLPAGAINDAWVVGYDPEYTISM
WYGYKKITDGYNKASTAGNERTKLYRALENVIFKKNNDKKFTVPSNLINVCVEKGSNPAA
LPSAGTPQDQITCEYFVKGTEPTESSSRYNKLDTVSNLKVTYDENTKKVTISWSKLNTPT
ANESFGDFGYNVYYGDVLLDFTTENSYTIQANSNISGTYKVITTFKNYAGNQSDPAVYNF
EYNNETDTAVYNLITEGTNPVTITATETYNDLDIPVQLLKNGSSINSEVNIKSILKTTIK
DPSGNPINNISGSSENQLATGTYTITYTVTYKGKTYTTTRKVIVN

Enzyme Prediction     

No EC number prediction in MGYG000004391_00083.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	130	309	6.1e-51	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	2.16e-155	105	747	38	654	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.72e-102	114	757	40	779	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	1.41e-69	105	663	17	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	4.14e-60	130	310	2	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
PRK11636	mrcA	6.79e-47	125	746	50	832	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APH04640.1	9.86e-165	102	785	54	725
AYA76804.1	4.29e-157	99	822	53	772
QNG61477.1	6.46e-157	68	836	23	779
ASA95728.1	2.00e-156	68	785	14	727
AXM90108.1	2.86e-156	68	836	14	776

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	6.93e-93	125	694	10	587	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	2.02e-88	108	694	2	596	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	3.12e-56	229	666	2	434	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	8.14e-52	229	666	2	434	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2ZC5_B	8.54e-51	341	707	5	377	ChainB, Penicillin-binding protein 1A [unidentified],2ZC5_D Chain D, Penicillin-binding protein 1A [unidentified],2ZC6_B Chain B, Penicillin-binding protein 1A [unidentified],2ZC6_D Chain D, Penicillin-binding protein 1A [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	6.63e-140	99	774	53	728	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q04707	7.22e-95	72	707	2	640	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q00573	1.35e-94	102	688	32	622	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q8DR59	2.69e-94	72	707	2	640	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
Q891X1	4.40e-72	103	744	40	708	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999871	0.000153	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	40
45	67
80	102