CAZyme Information: MGYG000004391_00364

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UBA7057
• CAZyme ID: MGYG000004391_00364
• CAZy Family: CBM50
• CAZyme Description: Cell division suppressor protein YneA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		44869.74	5.2921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004391	549473	MAG	Israel	Asia

• Gene Location: Start: 80598; End: 81818 Strand: +

Full Sequence      

MGDYKIIVDAGHGGEDPGAVSGNLKEKDFNLQAANYMYNRFKELGVPVAITRDSDVTLTR
QERLNTMTNTFGTSPNVIILSNHINSGGGEGAEVVYPLRSTDVLARSILEAIGEEGQIMR
KYYQRRLPENPSKDYYYIMRETPNTTSLLLEYGFIDNPKDAAKLQNYLLDYVEAVVKAVS
NYIGVKYVAPSGSLENTYTVKAGDTLYSIARRFDLSVNELKALNNLTSNNLSIGQVLIIK
EEADIPPQPSNGITYIVKSGDTLYKIANQYNVTVAEIIDLNNLSTTVLTIGQELLIPDKS
IDKTETYTVKKGDSLYKIANQFGITVDDIISSNNLTSTTLQIGQVLTIPTSSTIKPGTNF
ITYTVKKGDSLWQIANTYNTTVDQIKRLNNLTSNNLSIGQQLKIPR

Enzyme Prediction     

No EC number prediction in MGYG000004391_00364.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	363	405	5.6e-18	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	2.50e-46	191	404	326	591	1,4-beta-N-acetylmuramoylhydrolase.
cd02696	MurNAc-LAA	5.96e-33	5	179	1	171	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.
COG0860	AmiC	7.34e-29	2	184	41	229	N-acetylmuramoyl-L-alanine amidase [Cell wall/membrane/envelope biogenesis].
pfam01520	Amidase_3	2.07e-27	6	183	1	172	N-acetylmuramoyl-L-alanine amidase. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls.
PRK10783	mltD	3.45e-21	281	402	320	444	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVK20078.1	7.53e-62	6	349	2	284
AGK53921.1	1.48e-47	197	405	100	323
QIC05530.1	1.24e-45	6	193	85	266
AXY24739.1	2.45e-43	197	406	665	885
AYB39952.1	2.85e-43	6	192	157	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	3.24e-16	250	406	39	218	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
5J72_A	5.12e-15	6	185	454	631	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
4RN7_A	7.52e-12	4	186	4	185	ChainA, N-acetylmuramoyl-L-alanine amidase [Clostridioides difficile 630]
1JWQ_A	2.45e-08	6	186	4	179	Structureof the catalytic domain of CwlV, N-acetylmuramoyl-L-alanine amidase from Bacillus(Paenibacillus) polymyxa var.colistinus [Paenibacillus polymyxa]
7RAG_B	1.86e-07	6	186	19	206	ChainB, Germination-specific N-acetylmuramoyl-L-alanine amidase, Autolysin [Clostridioides difficile]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31852	1.12e-33	178	404	10	268	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
O07532	3.64e-31	196	404	92	350	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
P37710	2.02e-26	198	404	499	736	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	1.57e-24	196	406	412	666	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q8CMN2	1.32e-23	197	349	28	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004391_00364.