CAZyme Information: MGYG000004401_00321

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UMGS1045
• CAZyme ID: MGYG000004401_00321
• CAZy Family: CBM50
• CAZyme Description: Peptidoglycan endopeptidase LytF

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
285		31738.78	8.9667

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004401	1270934	MAG	Israel	Asia

• Gene Location: Start: 84896; End: 85753 Strand: -

Full Sequence      

MEYRDLSTTPSSEYYTVKSGDSLWSIAKKYGISVDELKAANNLTSNVLQIGQRLNIPSMS
GITTKPENYINYTVKSGDSLYSIASKNDLTVQELKNYNNLTSNVLQIGQILKIPVVSTEE
VPIGKYSEYVVKSGDSLYSIGRKYGYTPQQLIDYNNLDSTILSVGQVLKIPTVSSDLEQT
NYIEYTVKSGDNLYSIGRKYGVSPQELMNYNNLKSNLLSIGQTLKIPTSSSGTNTTYIEY
KVKSGDNLYSIGRKYGYTAQELMNYNDLKSNLLSIGQTIRIPLSK

Enzyme Prediction     

No EC number prediction in MGYG000004401_00321.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	15	57	1.1e-19	0.975
CBM50	185	227	2e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	1.80e-38	7	281	325	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK13914	PRK13914	1.21e-21	8	244	23	258	invasion associated endopeptidase.
PRK10783	mltD	4.02e-21	162	272	322	438	membrane-bound lytic murein transglycosylase D; Provisional
PRK10783	mltD	9.76e-19	8	108	339	441	membrane-bound lytic murein transglycosylase D; Provisional
PRK10783	mltD	1.42e-16	103	217	320	438	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APB30413.1	2.16e-57	7	282	157	476
AXY24739.1	3.72e-56	7	281	591	883
QUF66404.1	3.76e-55	6	281	19	331
ASR40346.1	1.25e-54	7	284	389	709
AIK48932.1	2.05e-54	6	281	19	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	2.52e-10	15	171	44	217	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
4UZ2_A	3.69e-08	185	228	5	48	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
2MKX_A	8.32e-07	11	54	3	46	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]
4XCM_A	1.03e-06	129	172	5	48	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O07532	9.42e-46	17	281	31	350	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
O31852	1.86e-34	17	265	31	309	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
P37710	4.87e-34	11	281	427	736	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	6.56e-33	15	279	257	604	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
P54421	1.96e-28	11	175	24	197	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004401_00321.