CAZyme Information: MGYG000004402_00364

Basic Information

• Species: RC9 sp000432515
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000432515
• CAZyme ID: MGYG000004402_00364
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000004402_3|CGC3	43958.35	8.9601

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004402	3046184	MAG	Israel	Asia

• Gene Location: Start: 81422; End: 82582 Strand: +

Full Sequence      

MKISKKLKVVLKYLIPTVIVMVGVPLLQRTTNRREPFEKDTLRCVIGIKNSPSMRYAVGY
NYEMLQLFAWELGKNTDIMLGGKEYIDSLKNGAVDIVVMPFDDSLIFDQSVFASIPLADS
SSWLVHGRLRPEHYEVNHWLSTFNITDEHKIIKGRFSPGYEPYRRLRKGWIYRTLSPYDD
LIRKYSAELGWDRTMLTALIWQESQFHIEAQSRRGAIGLMQLMPHTADRYQADNLLDPEV
SIRTAVNYLKHLQNMFRPYASDRQELMKITLAAYNAGEGRIKDCMNYAASIGAPHSRWED
IVAVIPDMREDSILDADTVKLGKFQGYETINYVEKLTDLSRTFAAISGTKSSFDSKATGH
APSSPDPLRTRKDTAAAETASSPDKK

Enzyme Prediction     

No EC number prediction in MGYG000004402_00364.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	194	340	1.7e-22	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	8.82e-47	182	335	1	151	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	2.76e-28	177	282	3	110	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	8.30e-26	177	282	5	112	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	7.82e-25	195	283	3	87	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.13e-22	182	283	1	101	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CRY96252.1	3.71e-114	1	293	1	294
AGY53417.1	5.06e-44	38	345	37	349
QZT36545.1	2.00e-34	62	344	177	472
AKP50690.1	2.72e-31	74	346	186	463
QZE14494.1	1.12e-30	62	344	177	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O1J_A	4.84e-09	55	348	286	564	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	1.13e-08	57	348	300	560	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O24_A	1.14e-08	57	348	314	574	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.14e-08	57	348	310	570	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	1.15e-08	57	348	320	580	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	2.99e-19	171	336	279	441	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A3QCH2	2.11e-17	175	336	277	433	Membrane-bound lytic murein transglycosylase F OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) OX=323850 GN=mltF PE=3 SV=1
B0UUK3	5.17e-17	171	336	281	441	Membrane-bound lytic murein transglycosylase F OS=Histophilus somni (strain 2336) OX=228400 GN=mltF PE=3 SV=1
Q0I361	5.22e-17	171	336	281	441	Membrane-bound lytic murein transglycosylase F OS=Haemophilus somnus (strain 129Pt) OX=205914 GN=mltF PE=3 SV=2
B4RVK5	8.80e-17	174	336	290	447	Membrane-bound lytic murein transglycosylase F OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=mltF PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.947790	0.051469	0.000215	0.000188	0.000118	0.000237

TMHMM  Annotations     

start	end
9	27