CAZyme Information: MGYG000004402_00965

Basic Information

• Species: RC9 sp000432515
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000432515
• CAZyme ID: MGYG000004402_00965
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1365	MGYG000004402_11|CGC1	150409.17	5.8991

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004402	3046184	MAG	Israel	Asia

• Gene Location: Start: 39059; End: 43156 Strand: -

Full Sequence      

MKRIKLITVILLILFSLLAKGEDRIGVLQINVWQEGTCVPGGFDALVDNIIESGADVVFM
QEIRNYGGRRFIPRLIEALALKGVTFYGEDPTCDSGVISRFPLAQDGRKWEGCGSVQRVR
INAGGHPVALYAAHLDYTNYACYYPRGYDGNTWKKLPAPETSVEKILEMNRASGRDDTIR
DFIRLSRADIDEGIDVILAGDFNEPSHLDWTAQTASLWDHNGAVIPWDCSTMLYEGGFED
SFRVVNPDPVSSPGFTFPSDNSDCNPMKLTWAHESDERDRIDFIYYYGEGSLKPVDSKVF
GPAGSIVRGKRTVEENHSDIIPVTGKWPTDHKAVLTTFEFAPVARILTPSIPTIVDREHN
IICEICLESFSGKDVLESVGITVSGIDPSAIRNARLMYTGTSSAIYSRTTSYILKDQFRR
IGAGQDTWRHPAFAVQTASCKAGKDGRIVLKPEKSLVRDRNYFYLSLEVDSRKVDLSGTF
GVAVESVELRCPVQDGSGSLRRQARIVSEGSLEGHRFGIALRNYKDDNVFSYRIPGLVTT
PKGTLIAVYDIRHTSGNDLQDNIDVGASRSTDGGRTWEKMRTIIDMGEWGGLPQGQNGCG
DPSVLVDSNTGTIFVCALWTHGLGNRHAFSFASEGYEPISTGQMVLVKSTDDGKTWSKPV
NITRQVKRPDWRTTLQGPGRGITMQDGTLVFPMQCLDSKGIPSSGIMYSKDGGETWHCHS
RACERTTEAQVAEIAPGVLMLNCRNDRRQGRVVCVTDDLGKTWKTHPSSGSLVEPVCMAG
LLNIPASENIYGRDILLFSNPVSAPGKGRNHICIKASLDAGMTWNPLDCLLLDEEEGWGY
SCLTSIGNDKVGILYEGSTSHLVFQQVRLSDIVKSIPAPSGLSVGEIYSDDMIFQRDVPL
EISGRTAPGLEVKVTLGPSTRKCRSAQDGTWKVRMPALKAGTGIPFTVTDGRDTLSFSNV
AAGEVWLCSGQSNMAFELKGADTFSKEGLDDPMLRFYDMKSHLKTWGLVWSEEDAGKVAQ
GKYYDRTRWNCSSEKTAGEFSAVGYYFGKMLRDSLNVPVGLICNAVGGTTTESFISRSAL
EKVLPGFCDGWLEDKSVMEWARGRARENMSAFKGGYIQHPFMPAYLFENGIRPLERFPIK
GAIWYQGESNAENIPLHEILFRTLVDCWRQTWDNPDLPFYFVQLSSIERPTWPEFRNSQR
LLSLEIPHCGMAVSSDLGHPTDVHPRAKKPVGERLARLALRNDYGKQVECLAPAATKAFL
NDSGNVTVLFDSPISVPGTMPVRGFRICLEDGSEIPASAEISGSDAVILSRDAGRHDSAA
DSKNTKADSRTAIVKVKYAWDPWTDANLTGTTGLPVSTFDIEIGE

Enzyme Prediction     

EC	3.2.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	523	860	1.5e-89	0.9298245614035088

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	8.10e-93	526	861	8	328	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam03629	SASA	7.39e-24	963	1241	2	226	Carbohydrate esterase, sialic acid-specific acetylesterase. The catalytic triad of this esterase enzyme comprises residues Ser127, His403 and Asp391 in UniProtKB:P70665.
pfam13859	BNR_3	6.91e-20	534	812	1	259	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	2.51e-16	543	841	1	266	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd09084	EEP-2	1.05e-07	43	338	18	246	Exonuclease-Endonuclease-Phosphatase (EEP) domain superfamily; uncharacterized family 2. This family of uncharacterized proteins belongs to a superfamily that includes the catalytic domain (exonuclease/endonuclease/phosphatase, EEP, domain) of a diverse set of proteins including the ExoIII family of apurinic/apyrimidinic (AP) endonucleases, inositol polyphosphate 5-phosphatases (INPP5), neutral sphingomyelinases (nSMases), deadenylases (such as the vertebrate circadian-clock regulated nocturnin), bacterial cytolethal distending toxin B (CdtB), deoxyribonuclease 1 (DNase1), the endonuclease domain of the non-LTR retrotransposon LINE-1, and related domains. These diverse enzymes share a common catalytic mechanism of cleaving phosphodiester bonds; their substrates range from nucleic acids to phospholipids and perhaps, proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDT62262.1	1.58e-170	487	1363	295	1442
AWI09525.1	1.59e-162	517	1361	278	1124
QRX63221.1	1.66e-162	335	876	15	543
AVM54056.1	2.98e-154	351	876	30	543
QUT76823.1	3.55e-153	351	874	51	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MYV_A	9.85e-150	351	874	11	522	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	2.39e-149	351	874	32	543	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
4Q6K_A	4.82e-142	351	874	14	525	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]
4FJ6_A	9.69e-139	351	873	12	521	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]
6MNJ_A	4.48e-137	345	874	25	539	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31206	2.33e-151	351	874	33	544	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
P29767	5.25e-33	531	960	394	927	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
Q02834	1.88e-29	531	951	66	474	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P70665	2.43e-28	863	1343	7	511	Sialate O-acetylesterase OS=Mus musculus OX=10090 GN=Siae PE=1 SV=3
P15698	1.86e-27	525	858	44	382	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000290	0.998960	0.000266	0.000152	0.000150	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004402_00965.