CAZyme Information: MGYG000004402_01108

Basic Information

• Species: RC9 sp000432515
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000432515
• CAZyme ID: MGYG000004402_01108
• CAZy Family: GH77
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
709	MGYG000004402_14|CGC1	81879.49	6.5496

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004402	3046184	MAG	Israel	Asia

• Gene Location: Start: 21788; End: 23917 Strand: +

Full Sequence      

MTRTFRITYQTSWGEEIKLISGEKQADMHYLPGGIWETSLPGKSLPAGAEYHYECWKDGR
RVRREWKNHIVPDSKETELYDQWTDIPAAAPFFTSAFADKVFSIDQDSFKVNEETTPQDM
YRSGWKCAGTAVPVFSLRTEDSFGIGDFHDLKKLVDWVAATGQRVIQLLPVNDTTMTGTW
TDSYPYSANSIYALHPQFVYLPDAGVRRDAKYKALKAELEALTEIDYERVNQEKDRLMRK
AFASTWAKVSVSAEYQKFIKDNAEWLDAYCAFRILLHKTGTGDSAKWGKYATYSAKKAAS
VLAENREEADYQSFVQFHLHKQLVDARNYARKHGVTFKGDLPIGVSRTSVDAWQHPSQFN
MNSQAGAPPDAFSADGQLWGFPTYNWDKMEEDNFAWWKARLKNMEQYFDFFRIDHILGFF
RIWEIPANAKSGLLGHFFPALPYSAKELADNGFDINSGCYTSDGVDTLFLEDPRKPGYWH
PRIGAQNTEHYRNLPDWQKDAFNRLHDDFFYRRHNAFWRDSALRKLPDLLASTRMLTCGE
DLGMIPDCVPDVMRELRILSLEIQRMPKDTRHEFADTRSYPYLSVCATSTHDMSPLRAWW
KEDRGVTQRFWNQVLGKPGEAPADCTPDISLSIIMMHLQSASMLAILPLQDYLSLKPELC
FDDPDKERINVPAISPFYWRFRMKTTIETLINDDITGYLRTLIRNCGRR

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	132	702	1.6e-144	0.9858299595141701

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN03236	PLN03236	0.0	125	708	59	741	4-alpha-glucanotransferase; Provisional
PLN02950	PLN02950	0.0	122	694	256	903	4-alpha-glucanotransferase
pfam02446	Glyco_hydro_77	0.0	132	686	1	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
COG1640	MalQ	4.29e-107	129	704	15	514	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14508	PRK14508	5.43e-102	132	708	11	496	4-alpha-glucanotransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL78633.1	2.83e-257	1	709	1	867
AFL78258.1	2.11e-254	1	709	1	867
BBL00124.1	1.07e-251	7	709	7	866
CBK62792.1	1.56e-251	1	709	1	867
BBL08204.1	2.45e-250	7	709	7	866

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TZ7_A	7.56e-41	123	684	19	484	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
1X1N_A	1.38e-35	117	708	22	523	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	2.48e-35	117	708	74	575	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]
5CPQ_A	1.18e-30	144	708	86	563	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
6M6T_A	1.66e-30	126	440	5	322	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q69Q02	1.99e-161	66	708	201	921	4-alpha-glucanotransferase DPE2 OS=Oryza sativa subsp. japonica OX=39947 GN=DPE2 PE=2 SV=1
Q8RXD9	1.54e-159	125	708	268	927	4-alpha-glucanotransferase DPE2 OS=Arabidopsis thaliana OX=3702 GN=DPE2 PE=1 SV=1
Q9Z8L2	2.75e-66	125	703	16	523	4-alpha-glucanotransferase OS=Chlamydia pneumoniae OX=83558 GN=malQ PE=3 SV=1
O34022	1.47e-61	129	694	30	517	4-alpha-glucanotransferase OS=Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC) OX=227941 GN=malQ PE=3 SV=1
Q9PKU9	1.81e-59	129	690	30	513	4-alpha-glucanotransferase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004402_01108.