CAZyme Information: MGYG000004403_02340

Basic Information

• Species: Agathobacter sp900550545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900550545
• CAZyme ID: MGYG000004403_02340
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494		57593.67	4.973

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004403	2627762	MAG	Israel	Asia

• Gene Location: Start: 10105; End: 11589 Strand: -

Full Sequence      

MINEALKKACEYERKKEQEISSQERPVFHLSPRVGWMNDPNGFSYYDGKYHLFYQYHPYD
TVWGPMHWGHAVSDDLLHWEYLPVAIAPDEKYDKDGCFSGSALALDDGRHLLMYTGVRRE
EQPDGTVRDIQAQCIAVGDGLKYKKYEKNPVLGENDLPEGSSKFDFRDPKMWRGTDGRFY
CVVGSRHVKNQGQILLFSSDDGFDWKYDTTLASNNNRYGRMWECPDFFKLGDKWLLITSP
QDLVPQGLEFDNGNVTLCIAGEYNAQNEKFTEQNVQTLDYGIDFYAPQTILAPDGRRIMI
GWMQNWDTCQMCPEDAKWFGQMSLPRELFWKDGRVCQKPVREVDAMRSECIRFSNVTVSG
DFKLDEICGRMIDMEIFLRPNDVNNHYRKFRIDFAENDQYYTSLIFDPIEDTLEIDRKHC
GSRRAINHQRKCRANYKNNELKLRIILDRYSAEIFVNDGESVITTTMYTDQNADSVSFYA
DGKAQMDIVKYNLD

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	29	339	1.9e-104	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1621	SacC	4.53e-152	11	494	15	485	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
cd08996	GH32_FFase	3.63e-136	35	330	1	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
pfam00251	Glyco_hydro_32N	4.32e-133	29	339	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	4.46e-127	29	459	1	437	Glycosyl hydrolases family 32.
TIGR01322	scrB_fam	2.46e-125	13	470	2	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL25413.1	2.42e-231	2	493	1	493
AUS98816.1	5.37e-215	2	493	1	490
AYB00604.1	3.15e-211	6	493	5	496
QUI96651.1	4.47e-211	2	490	1	493
ADL34440.1	1.07e-210	2	494	1	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	4.83e-91	19	484	20	474	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	3.57e-90	3	470	26	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	5.52e-89	3	470	26	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NUM_A	1.43e-78	26	481	41	498	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
3PIG_A	1.44e-76	26	490	41	508	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16553	1.63e-104	26	480	25	460	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P40714	1.36e-93	26	480	26	461	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
F8DVG5	2.50e-86	20	490	24	495	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) OX=555217 GN=sacA PE=3 SV=1
P0DJA7	1.63e-83	20	490	24	495	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) OX=264203 GN=sacA PE=1 SV=1
P27217	8.63e-81	18	468	20	438	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004403_02340.