CAZyme Information: MGYG000004415_01529

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004415_01529
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310		35574.13	7.4778

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004415	2114977	MAG	Israel	Asia

• Gene Location: Start: 5139; End: 6071 Strand: -

Full Sequence      

MDFGFDRILNEYPDTFEGYFIFDADNVISRDYVSKMNDAFDQGFHVVTSYRNSKNFGSSW
ISAANATWYLREARFLNNARNICKTSCAVSGSGYLISASVIEGMHGWQFHTLTEDIQFTT
FCAIHGIRIGYAPAEFFDEQPVTFKASWKQRMRWTKGFYQVFFTYGKHLVKSTFRYHRFA
AYDMFMTIAPGMLLSLISMLANATFLIVGGLSHGFLATEVEMQACAASLIMTFAMMYLTF
FILALLTTIFEYKHIHCAQKWRLVTNLFTFPIFMFSYIPITVAALFLKVDWVPTQHAVNV
TLDEVMQGAK

Enzyme Prediction     

No EC number prediction in MGYG000004415_01529.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	21	230	3.4e-16	0.9035532994923858

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	1.35e-45	1	118	68	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	7.60e-20	20	283	142	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13632	Glyco_trans_2_3	3.09e-12	23	209	6	189	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
pfam13641	Glyco_tranf_2_3	3.60e-11	21	157	93	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06423	CESA_like	6.74e-08	20	115	83	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33195.1	6.46e-224	1	310	122	431
AZH69681.1	3.73e-223	1	310	122	431
ATP53496.1	1.07e-222	1	310	122	431
AEB07123.1	1.55e-169	1	310	122	431
AKT50107.1	2.06e-151	1	310	119	428

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.62e-06	89	157	210	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
186	208
228	250
263	285