CAZyme Information: MGYG000004420_00192

Basic Information

• Species: RUG841 sp900313795
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; RUG841; RUG841 sp900313795
• CAZyme ID: MGYG000004420_00192
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000004420_2|CGC1	42149.57	8.5206

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004420	2033021	MAG	Israel	Asia

• Gene Location: Start: 59917; End: 61032 Strand: +

Full Sequence      

MKKIFIITGEYSGDKHASCVTREIFKANPDVSIEAVGGSNLAAAGVKLFCNHEKMSAMGF
NFKILIDHIMLGKKIADYLINEYKPDLVLLVDYGGFNLNIAKILKRAGLKIFYYIPPQIW
ASRKWRINTVKRYIDKVITIFPFEIDMYRQAGVDAEFAGHPLVSQLPTVTTKEQLYEEFQ
LDKTKKLVSIFPGSRVFEIKNLLTLFIDAAKIIKEKNPDTQFVICQAPTIKDELLQGIPK
DIKIIKNKNYELLANSDVLMLASGTVALEAALYGTPMIISYKGPEFIYWIYLLVRCINRV
SLPNIITDKDIVPELVQHLAKPEIIAEHISSLLSDKEKYDEMKKDLKDVKHFLTDKVSCE
EAAKIILQNLQ

Enzyme Prediction     

No EC number prediction in MGYG000004420_00192.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	352	4e-103	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	9.18e-112	1	368	1	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.52e-105	1	371	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.85e-70	4	366	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.75e-66	4	368	8	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	5.11e-46	53	368	46	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	3.65e-143	1	370	1	372
AGB42297.1	1.86e-77	6	367	2	368
ADE14391.1	1.35e-75	4	350	8	359
AIH04159.1	3.09e-75	3	353	8	360
ADR19367.1	3.56e-75	1	339	1	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.46e-41	4	335	9	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	3.96e-41	4	335	9	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3JAC1	1.15e-73	4	353	8	362	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
Q2LVL8	7.03e-71	2	367	4	375	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	3.92e-70	2	337	7	347	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	8.01e-70	2	370	7	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	9.78e-68	3	370	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004420_00192.