CAZyme Information: MGYG000004420_01116

Basic Information

• Species: RUG841 sp900313795
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; RUG841; RUG841 sp900313795
• CAZyme ID: MGYG000004420_01116
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437	MGYG000004420_9|CGC1	50858.2	7.7049

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004420	2033021	MAG	Israel	Asia

• Gene Location: Start: 83317; End: 84630 Strand: +

Full Sequence      

MRGRLVLLSIIVGLWVFLFIFQNYFNTFWALVALISIMGVYSVYIYLANKHRVRVLKKHP
VEVNQDYKPLITIMIPCHNEGIVIHKTVENITAVDYDNYELILIDDRSDDNTAEVIKQIA
KENHNIKYLIREKSAFPGKSAVLNDALEMAHGEAVLVFDADARINPDFIKNLIPKLEPED
VGAVQARKVISNRNDNFLTRCQDNEMALDTHFQIGRDAVKGAVELRGNGELIKRKALEDI
GGWNNYTITDDLDMSTRLQIKGWDIRFCPDVCVYEEGVMRIVPLLRQRRRWVEGSIRRYL
ENFWAVLFSKDMSLRASLDMTAYICEFLLPFWFFSEVGFQIFRYIKYDENQILSSLTLAV
LIFIFFYSALVYSLRKYNHLKPLENIRQSFETCAYLLVLWFPVVTFIIFKIIFTKKTMDW
GKTQHGTAKSEEPALVK

Enzyme Prediction     

No EC number prediction in MGYG000004420_01116.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	71	292	4.3e-39	0.9739130434782609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	3.16e-57	14	415	9	409	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.47e-53	73	251	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06437	CESA_CaSu_A2	1.72e-44	69	295	1	232	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
PRK11204	PRK11204	1.10e-43	10	416	2	405	N-glycosyltransferase; Provisional
pfam13641	Glyco_tranf_2_3	1.03e-34	69	292	2	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38294.1	1.02e-161	47	435	3	393
BDA68096.1	9.77e-72	36	425	80	463
BAY54344.1	1.11e-70	28	428	65	469
BAS59315.1	1.11e-70	28	428	65	469
BAS65663.1	1.11e-70	28	428	65	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	6.42e-12	116	337	193	410	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	6.73e-12	116	337	205	422	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	6.73e-12	116	337	206	423	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	1.34e-08	56	297	258	503	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
1H7L_A	5.42e-07	69	184	1	121	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3MB01	1.74e-64	31	425	75	463	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q8YMK0	4.81e-64	31	425	75	463	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
P74165	6.47e-57	69	330	108	371	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8GLC5	1.96e-26	71	314	49	290	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HCN1	4.99e-26	42	314	22	290	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	22
26	48
320	342
352	374
394	413