CAZyme Information: MGYG000004422_01604

Basic Information

• Species: Collinsella sp900762015
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900762015
• CAZyme ID: MGYG000004422_01604
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304		32923.59	4.0785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004422	2126076	MAG	Israel	Asia

• Gene Location: Start: 26; End: 940 Strand: +

Full Sequence      

MHGEGAGRDVGEILVYGSDDMLSWELENRVSTPERFGFMWECPGYLELEADGDAPAKFLS
FSPQGLEGGRWDRGNVYAAGYMPVTGDITGGDGAYELGDFRLWDAGFDFYAPQEFTAEDG
RHILIGWMGMPDEPTYDNAPTVACGWQHCMTVPRELIAGAGGVVLQQPAREIEHHYVSVR
VGAGSLEVAGDTCFDVVVDGVDDAFAATVDGELKLAFMPAEGELPARFEMRFADESRASA
GRGRTVRWEPIDEVRNVRIVGDASSVEVFVNDGALVFSTRIYPDAYGVSVNAPGAGVTYH
ALSI

Enzyme Prediction     

No EC number prediction in MGYG000004422_01604.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	8	168	9.3e-34	0.49146757679180886

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	5.98e-60	5	156	141	285	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG1621	SacC	5.19e-54	5	299	180	477	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
TIGR01322	scrB_fam	1.73e-51	11	284	172	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam00251	Glyco_hydro_32N	1.04e-40	3	168	149	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	3.65e-36	5	273	152	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33159.1	1.06e-205	1	304	210	513
SDR64968.1	1.03e-109	4	304	188	483
ADK67558.1	3.95e-98	4	298	184	476
AEB06470.1	1.61e-90	9	302	214	527
AKT49546.1	8.82e-89	4	304	184	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NUM_A	2.01e-26	11	282	204	485	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
3PIG_A	1.17e-24	11	282	204	485	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
7VCO_A	1.00e-20	9	283	183	459	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	8.36e-20	11	292	203	470	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	8.36e-20	11	292	203	470	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.12e-36	11	296	185	467	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	1.80e-34	11	299	192	481	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P40714	4.48e-30	9	295	182	472	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P27217	2.74e-29	11	283	183	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
Q56660	2.79e-29	11	297	252	526	Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae OX=666 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004422_01604.