CAZyme Information: MGYG000004423_00873

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-698; DUOT01
• CAZyme ID: MGYG000004423_00873
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509	MGYG000004423_7|CGC1	58060.8	6.5053

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004423	1147030	MAG	Israel	Asia

• Gene Location: Start: 15129; End: 16658 Strand: -

Full Sequence      

MTLEEKIGQMLCFAFQGTTYNSQLKTLIEDMKIGTIIHFARNVENIRQVYALNKEIVKHS
SIPPFIGIDQEGGMVRRVQNEITYLPGAMALTNSSNDMIYQIYYKTAVELKKLGYNLNFM
PSLDINNNPYNPVINSRSYSDDKDIVKEKGYIACKAMQDALVLPTPKHFPGHGNTNVDSH
VGLPVVKDSFNSIHNTELVPFKYVIDKGVDGIMVSHILYEQIDNEYPSTLSKKVINDLLI
NELGFKGLVITDSLTMSAIWGHYSISEIVEKAINAGNDIIMFCGRADNEEQKEIYNAFID
LVKKGKIKEERIEASVNKILKLKEKYASNTLKEVDFDHDFNLGKALSHELTINSITLYKD
NNLLPINKDKVISLFPKINLATLVDNVNNNYESIGTHLKCDEIIYCEENEKDFEKIVQKT
QKYDKILLATYNVKEGDYQTKLFNMLDKHKTICVALRSPYDLLMLKDVSTYICTFDVSKE
SIRALVECLQKNQFNENLPVKIEQRRGLK

Enzyme Prediction     

No EC number prediction in MGYG000004423_00873.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	58	281	2.3e-56	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	3.94e-88	1	368	1	352	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.35e-76	2	322	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.90e-47	17	287	10	284	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.82e-16	1	374	45	415	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR67877.1	5.58e-108	1	489	5	502
ABY91501.1	2.95e-101	1	502	1	520
ADD01527.1	3.40e-101	1	502	6	525
AEM77732.1	1.49e-99	1	502	6	525
AST92910.1	1.95e-98	1	502	7	524

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.41e-85	1	485	11	513	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	2.58e-65	3	502	9	527	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
3BMX_A	1.08e-60	1	323	42	393	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	3.55e-60	1	323	16	367	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	6.14e-60	1	323	46	397	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	5.90e-60	1	323	42	393	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	5.06e-54	18	400	49	461	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q0AF74	2.30e-42	17	291	12	291	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
Q82SJ8	1.46e-36	17	291	12	291	Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=nagZ PE=3 SV=1
A1SW90	3.05e-36	16	283	9	279	Beta-hexosaminidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004423_00873.