CAZyme Information: MGYG000004424_01188

Basic Information

• Species: Collinsella sp900548365
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900548365
• CAZyme ID: MGYG000004424_01188
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
495	MGYG000004424_62|CGC1	54751.13	5.0084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004424	2127341	MAG	Israel	Asia

• Gene Location: Start: 7035; End: 8522 Strand: -

Full Sequence      

MTQHKPRPACVSRRAFLAGSTVLAAVASPRVASAAQPATNIPTLNTYDEYVAWADANYQP
DPLDYGSSDANALAYRGWRDHEWKETVSGKAFYDGNGKLFASPAVKVIDVSEHQRTIDWD
DVKKSGVDAAILRCGYGIGNEDAKFARNVAECERIGMPYGIYLYSYAYDADFAAQEGGWT
AELLKRYDAHPTLPVYYDLETWSWTGHQPPTEPKVYEQIVDAYFGALQKAGCTNVSIYSY
TGLLKGALKSPAIWKRTSWVAQYAAELQFDFSTYAPACYGWQYTDVGQVDGIAGNVDINA
FTPFKLYGFEDVTPATPHHEDIGWLKERGITEGFPDGTFRGEASIARQDMAAMLYRTAGS
PAYEPSKIDRQRFADITPDTPHFKEICWAGSEGIAQGWDDKTFRGLESVARQDMAAFLYR
LAGSPSYVPGASDAQRFADVTAATPHAKEIWWLADAGITEGFPDGTFRGLAPVARQDMAA
FLHRLHVFMNGTFPF

Enzyme Prediction     

No EC number prediction in MGYG000004424_01188.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	108	292	2.4e-34	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	8.42e-68	106	301	2	190	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	2.26e-29	106	301	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06523	GH25_PlyB-like	1.23e-20	106	300	1	176	PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06413	GH25_muramidase_1	3.68e-18	103	301	1	189	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
COG3757	Acm	9.13e-18	104	301	62	253	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT17570.1	1.09e-242	12	493	24	504
ATO39491.1	4.18e-119	37	485	10	471
AIZ16865.1	6.06e-118	53	485	19	468
ACS48426.1	5.72e-117	97	485	130	531
ACS46860.1	5.72e-117	97	485	130	531

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	1.69e-39	89	301	251	467	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	4.42e-39	89	301	251	467	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
1JFX_A	3.37e-10	105	301	5	202	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6CRV0	1.15e-11	302	485	1269	1458	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P25310	4.40e-09	105	301	82	279	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
Q06848	1.97e-07	319	484	227	396	Cellulosome-anchoring protein OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=ancA PE=1 SV=1
Q06852	4.49e-07	326	484	2099	2262	Cell surface glycoprotein 1 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=olpB PE=3 SV=2
P34020	5.48e-07	105	308	1	187	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000000	0.999965	0.000014	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004424_01188.