CAZyme Information: MGYG000004428_00935

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000004428_00935
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	MGYG000004428_6|CGC1	53104.96	4.8061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004428	2425862	MAG	Israel	Asia

• Gene Location: Start: 25298; End: 26737 Strand: +

Full Sequence      

MKYSRIIALALAAAVLSPASARSYKRGVSENQFSLGAQMEVLTPGVSWYYNWANTPGKGW
QSEVINFEGYDFVPMVWNNRYNADAIREYVRSHPNVKYLLGFNEPNFTAQSNMTPAVAAQ
YWPEVVALARELGLKLVAPAMNYSPNAPYQQPTKWFDEFVALVGKDAFDFVAIHNYGGLG
VMKTLATEFHERYGKDVWVTEFCYWPNEGNASSRVEPVVQVASMVETVEWLEKTPWIYRY
AWFKPIGRHENTPSTGSPCYGLVITENGTGPRTLSPQGYVYVYMSEFNPDIWHAVAEEVP
ATEYISQTLCQLWPGNNPQAPLPIEISQFSAGATLDYQFDVPADGAYNLVLTVSGQGEPV
RFDPCVGVSLVEGENATVLVAPAAFTLPGSDTEYVERTFSLNLKAGHQTLRLVDGNPYRP
SGIHISSLRLVQASGIEDVVLTPEDDTDAPTYTIDGRIVKAGSLAPGIYIRAGRKFIVR

Enzyme Prediction     

No EC number prediction in MGYG000004428_00935.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	44	245	4.5e-54	0.8482142857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam11790	Glyco_hydro_cc	6.77e-58	45	281	17	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93826.1	6.27e-61	22	412	51	427
ARU26557.1	1.12e-47	23	412	115	483
QKX17146.1	1.38e-45	20	413	738	1104
AYN96242.1	3.00e-45	20	251	29	261
ABD82184.1	3.45e-45	22	415	735	1105

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAV_A	3.85e-41	22	243	2	226	Crystalstructure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) [Pseudomonas viridiflava]
6UAW_A	7.03e-41	22	243	24	248	Crystalstructure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) in complex with laminaritriose [Pseudomonas viridiflava]
6UAX_A	4.60e-34	25	251	95	322	Crystalstructure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UAQ_A	3.00e-21	25	257	25	255	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	7.57e-21	25	257	25	255	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000468	0.998475	0.000301	0.000276	0.000232	0.000208

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004428_00935.