CAZyme Information: MGYG000004428_01992

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000004428_01992
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MGYG000004428_23|CGC1	37855.92	9.9807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004428	2425862	MAG	Israel	Asia

• Gene Location: Start: 9797; End: 10792 Strand: -

Full Sequence      

MLSGPEVYDSSRKSAANSVYKLEGFRIYRTDCRSFNKNSLIGKAKSFISTTLSLYKLAKR
HIRPGDKVLLVTNPAPLILFMSRLKRKRRFELNILVHDVFPENTIAAGVKLPLYGFVKSL
FDKAYSRADKLIVLGRDMAQIMSRKTKNKVDLRIIENWGDFENIHEAPMPQSDRIILQYA
GNIGRVQGLDKIIESLPENIEFHLYGSGAMEDRLKAYNKPNVFFHGPYARNEQSDILSKC
HISLVTLNDKMYGLGTPSKTYNILASGRPILYFGPSESEIELLIKEHGIGYIGWPECWDI
PTLQRMGKEARRIGEQLYSEKSILQKFRDMI

Enzyme Prediction     

No EC number prediction in MGYG000004428_01992.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	1.26e-54	1	327	36	390	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
PRK10307	PRK10307	2.60e-11	46	327	90	401	colanic acid biosynthesis glycosyltransferase WcaI.
cd03801	GT4_PimA-like	1.03e-10	69	331	85	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
PRK09814	PRK09814	3.55e-09	79	292	83	283	sugar transferase.
COG0438	RfaB	1.33e-08	16	331	41	374	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT70675.1	2.18e-131	1	327	41	369
QDH56224.1	5.06e-130	1	327	41	369
ALJ41675.1	3.43e-129	1	326	41	373
QWA40247.1	3.31e-85	1	331	37	401
VFA41945.1	2.97e-83	1	331	37	401

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8KIU8	1.60e-40	36	327	66	387	Probable glycosyltransferase WbjE OS=Pseudomonas aeruginosa OX=287 GN=wbjE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004428_01992.