CAZyme Information: MGYG000004429_00082

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; CAG-274
• CAZyme ID: MGYG000004429_00082
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1067		111298.79	4.362

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004429	2352873	MAG	Israel	Asia

• Gene Location: Start: 10876; End: 14079 Strand: -

Full Sequence      

MKRVFTKLASAALAATMVLSVVPPVSGLNEAVPLAVETAAASTVNIYSCAGVQEAAYIEW
AAVSGAAHYYVSYSSNGTSFTDIDDQLIRQYPDRWRADLIGLKAGSYTIKVTAKNSSGSV
VAEGTKTCTVVAHDRTGFTFHPSSTRYDGGGCGAYNADGTLKSNANVLYVTEDNFDTVSL
SLTTKDGKTATISGVTGICYTMGAAAAKGYSNPPLAIRFIGTIGDSHGDSTASLASPSLL
ETKGADGSPSVNITFEGVGQDTIFYGLGLRLNGVGNCEIRNIAFYNWHDDAIQLQGNGNS
NHWIHNNDLFYGENHGGDQAKGDGATDVKDDSKYITYSYNRYWDCGKTSLCGMKSETGDN
YISYHHNWFDHSDSRHPRIRTMFVHVYNNYYDGNAKYGVGAAKSSSAFVEGNYFRNCNHP
MLSSLQGSDIMANEKTGEADFSAGGTFSSEAGGIIKAYNNYIEGADNNERTGGSEPVYYD
ASDTATNGAATQFDAYLASSRDEQVPSSVKALSGGKTFDNSNVDSYILSIPVEEPATAKN
KVTTYAGRTGDHFSFTFTSADDTDYAINTSLKSKLDTYATDTSDDYVSVGGAADGSGPVE
TTTKVTESTTNAEASTETTTKTVEGSTETTTKTDESTETTTVDSNGAASMGTYVFGDSAS
GGDFNITDNGTYGNIAFSFRSIETTGAKLRSDNKSTFKLAGETEVSIVYVSGPGVTITDG
TNTYTFDDTDSMFRLPAGNYTLAGASSSNSIIASMTLKATGTTSSSSTTTTTETSTESTT
KETSTETTTQSSSDTGTVQVNPSATGYSFTTATAGKLTTDSTYGGASSNYNSSTNYVEIG
SNGAYLYDSSATDTTNGTTGVATTLTMPLAQTYTSGKLTVSGTVTPSASSSKWAYIDIQG
VNGSVVKIGTDDSKKLAISTTTNADGTNAYVSSSVLSAADTAYTYNAVLDLDAKSVTVTI
GGATLTTSLVNTSVDKLVATTSASAARNLTVGNITVAYEASTTPSVVKGDSDGDGDVDKD
DVTNVLAYAVGKVATVADAADVDGDGKVTVADAYKISQKVLGIISSL

Enzyme Prediction     

No EC number prediction in MGYG000004429_00082.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	252	416	1.4e-40	0.801980198019802

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	2.82e-45	228	420	83	279	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	1.28e-32	252	418	17	190	Amb_all domain.
pfam00544	Pec_lyase_C	1.69e-15	214	414	1	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
cd14256	Dockerin_I	0.001	1025	1061	18	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQR94278.1	2.60e-136	42	591	83	596
ACX62589.1	1.11e-135	38	598	31	567
AYB46946.1	4.55e-135	41	598	34	567
QOT09127.1	1.25e-134	38	598	31	567
AEI31450.1	1.84e-134	30	580	38	553

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	9.11e-22	211	416	42	248	Crystalstructure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1VBL_A	5.96e-16	252	414	133	330	Structureof the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]
1AIR_A	8.43e-14	290	496	129	337	ChainA, PECTATE LYASE C [Dickeya chrysanthemi],1O88_A Chain A, Pectate Lyase C [Dickeya chrysanthemi],1O8D_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8E_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8F_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8G_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8H_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8I_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8J_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8K_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8L_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8M_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1PLU_A Chain A, Protein (pectate Lyase C) [Dickeya chrysanthemi],2PEC_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi]
2EWE_A	2.01e-13	290	496	129	337	ChainA, Pectate lyase C [Dickeya chrysanthemi]
5AMV_A	6.73e-13	252	412	128	323	Structuralinsights into the loss of catalytic competence in pectate lyase at low pH [Bacillus subtilis],5X2I_A Polygalacturonate Lyase by Fusing with a Self-assembling Amphipathic Peptide [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1B6T1	2.39e-22	204	423	73	281	Pectate trisaccharide-lyase OS=Bacillus sp. OX=1409 GN=pel PE=1 SV=1
Q65DC2	2.39e-22	204	423	73	281	Pectate trisaccharide-lyase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=BLi04129 PE=3 SV=1
Q8GCB2	2.39e-22	204	423	73	281	Pectate trisaccharide-lyase OS=Bacillus licheniformis OX=1402 GN=pelA PE=1 SV=1
Q5AVN4	1.10e-13	252	439	99	289	Pectate lyase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyA PE=1 SV=1
P0C1C3	3.11e-13	290	441	152	310	Pectate lyase 3 OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=pel3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000418	0.998864	0.000183	0.000202	0.000150	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004429_00082.