CAZyme Information: MGYG000004430_00838

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004430_00838
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000004430_5|CGC1	39429.45	4.3539

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004430	3945500	MAG	Israel	Asia

• Gene Location: Start: 66487; End: 67545 Strand: -

Full Sequence      

MKMTTIISAFALAATFLCSCSEDGPVTNPRQEDTSNIVKETGFARGADVSWLTQMESEGR
KFYTPGDDRQEMECMQLLRDHCGVNSIRLRVWVNPKDGWNNMDDVVLKARRAENLGLRTM
IDFHFSDTWADPGHQEMPEAWKNLSFDELTKAVGNHVTETLTALKNVGVTPEWVQVGNET
TPGMMLPVGSVDNPAQLTQLNNAGYDAVKSVFPDAMVIVHLDGGNNQWAYDRMFDILENN
GGKYDMIGMSLYPYWAEQQGETGGWLKIADDCIANINHLKQKYNKPVMICEIGMPYDQGE
LCNQLITKMMGTEVEGIFYWEPQAPNGYNDGYNLGCFDNDAPTVALDAFKTK

Enzyme Prediction     

No EC number prediction in MGYG000004430_00838.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	45	327	4.4e-91	0.8976608187134503

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	8.17e-97	44	349	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	3.78e-82	8	332	1	353	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT42647.1	4.89e-225	1	350	1	351
BCA49296.1	4.89e-225	1	350	1	351
QUT70301.1	6.94e-225	1	350	1	351
QMW86976.1	1.99e-224	1	350	1	351
AAO79773.1	1.99e-224	1	350	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GP5_A	4.51e-222	11	350	11	350	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],6GP5_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6GPA_A	2.52e-212	37	350	1	314	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482],6GPA_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482]
1HJS_A	6.57e-40	45	339	5	313	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
7OSK_A	2.19e-39	43	291	50	292	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
4BF7_A	2.05e-38	45	339	22	330	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	1.75e-48	38	322	1	310	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
P83692	3.60e-39	45	339	5	313	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1
Q65CX5	1.63e-38	3	322	1	347	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
Q5B153	1.08e-37	45	339	22	330	Arabinogalactan endo-beta-1,4-galactanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=galA PE=1 SV=2
A1D3T4	2.38e-37	45	295	26	272	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000071	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004430_00838.