CAZyme Information: MGYG000004430_00894

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004430_00894
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625		70774.64	6.8959

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004430	3945500	MAG	Israel	Asia

• Gene Location: Start: 149268; End: 151145 Strand: +

Full Sequence      

MKYSVFAFVCLSSVLMANASVGTLTLKSPDGRNEVNFSKNGKELLYSVRVDGKDVILPSR
AGLQLDNRVWEMALGKRDLVQPDCWMDMLVVDSVTYAAPVDSVWHPLYGERSAIRDHFNG
ATLHMSRKDKSKYRLDVQVRAYDEGIAFRYFFPEHPDAIFHKVTEDLTDYSFPKGANAWS
EQWAQARFDVGPVDSINRPVERALTLELPSGQWVALLDADVDDWCLTKYIARKDKPSTLS
SVMYSPVDVVTYAATPWKIIMTADSPAELLQNNDIVLNLNPASKGDFSWVKPGKIMRSKI
ATDAGLATIDFCAEHNIDYMLYDWQWYMPCTSHDGDATKVVPHVDMQKVIDYGKEKGVGV
WLYVNQHALMKQMDELFPILKQWGVVGVKSGFVQYASHRWSTWLHEMVAKAAKNGLMMNI
HDEFRPSGYSRTYPNLLTQEGICGNEEFPDATHNTTLPFTRMLNGAADYTICYYDKRLRN
THAHQLAASLVFYSPLQTIFWYDNPSLYQGEKEIKWFEDLATVFDDTKVLDGYPGKGITI
ARRKGDIWWAAALANNEGGNATFDLSRFLMPGKRYVAEIYSDEKEGKKKSRTGVAITQKK
VKSSDKLKFDIPAKGGVAIRFYPAD

Enzyme Prediction     

No EC number prediction in MGYG000004430_00894.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	14	621	1.4e-158	0.9857369255150554

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	1.86e-60	286	513	1	269	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	1.62e-56	28	281	1	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	3.54e-30	524	622	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT92217.1	1.06e-306	24	625	25	632
ALJ62032.1	2.47e-305	24	625	25	632
QDO69864.1	5.77e-304	24	625	25	632
QUT34121.1	8.18e-304	24	625	25	632
QUU00177.1	1.65e-303	24	625	25	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E1Q_A	1.24e-54	28	620	20	653	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3A24_A	9.40e-54	28	620	6	639	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
2D73_A	1.43e-51	12	616	11	716	CrystalStructure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2D73_B Crystal Structure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2ZQ0_A Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron],2ZQ0_B Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron]
3WFA_A	3.21e-51	26	616	5	696	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	3.24e-51	26	616	14	705	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	5.86e-55	1	620	1	660	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	3.42e-52	4	616	8	716	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
D7CFN7	4.05e-37	134	549	131	558	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000236	0.999071	0.000176	0.000175	0.000157	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004430_00894.