CAZyme Information: MGYG000004430_01954

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004430_01954
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788	MGYG000004430_18|CGC3	87846.19	6.3515

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004430	3945500	MAG	Israel	Asia

• Gene Location: Start: 77717; End: 80083 Strand: +

Full Sequence      

MKLKAFLSTLLLSLLSLSITARENILLDDEWTFSLTPDSASNLKPFTTVVDLPHDWSIAF
PFDRNAPMGNDGGYLPSGIGVYTKNINITPEDLKKNKYTLLFEGVYERWTLKVNGDSIGY
QPYGYSSVFFDITPALHPGENIIEVTADNSHQKNCRWYSGSGIYRHVHLIKTGHTHISPW
SLYVTTPRIETDNAQVKATFSIDGFEEATNLASTLSIIDQNGMSVAQETIPVKSQKTEHS
LTVASPKLWSPESPNLYTLQVAISSNGKVIDTTDAAFGVRTIEYSAEKGFLLNGKPMELN
GACVHHDNGILGAASYDAAEARKVRLLKEAGFNAVRTSHNPPAPAFLDECDRQGLLVIDE
VFDGWREAKNTWDYHLDFDKYSLADVGAMIRRDRNHPSIIAWSIGNEVIERKKIEVVTTA
RKLATECRRLDPIRPVTSALCAWDSDWEIYDPLAEALDIVGYNYMIHKSASDHERCPQRI
MWQTESYPADAFENWKKVAENPYIIGDFVWTGIDYLGESGIGRYFYKGQIEGEHYERPLW
PWHGAYCGDIDITGWRKPISHYRDFLYNDNRKLYMAVKEPTGYKGEIQTTKWGVSPTWES
WNWTGHEGKPIEIEVISRYPKVKLYLNDSLVGEKSVGKNAGFKAVFSIPYTPGTLRAEGC
DEAGNVIETTSIATTDKASAIRLTPDRTIMKADNQDVVFVIAEVVDSKGNVVPDADALLT
FKINGAGSILASGSADMTNPDSYSKPQTHSWKGRAIVAVKSGYKPGKITLTATSNRLKAA
KATLSVKK

Enzyme Prediction     

No EC number prediction in MGYG000004430_01954.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	21	578	5.8e-115	0.6170212765957447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.90e-71	22	542	10	528	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	2.42e-46	82	437	69	446	beta-D-glucuronidase; Provisional
PRK09525	lacZ	4.24e-44	26	407	54	462	beta-galactosidase.
PRK10340	ebgA	4.24e-39	60	464	95	490	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam18565	Glyco_hydro2_C5	2.13e-38	681	783	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36407.1	0.0	3	784	5	792
ADY34770.1	2.82e-299	14	770	23	777
QQY38007.1	2.21e-298	26	788	33	797
QUT68390.1	2.21e-298	26	788	33	797
QUT58832.1	2.21e-298	26	788	33	797

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RSK_A	3.46e-161	50	788	37	779	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6B6L_A	1.25e-160	50	785	37	776	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	1.06e-127	50	784	36	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	2.71e-121	50	773	42	794	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T98_A	5.42e-120	50	786	57	820	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	1.10e-130	19	780	39	842	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.13e-84	28	745	52	778	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	6.04e-46	79	787	57	737	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	1.49e-45	50	634	82	675	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	1.96e-38	50	784	58	793	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000454	0.997959	0.001035	0.000177	0.000167	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004430_01954.