CAZyme Information: MGYG000004430_02909

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004430_02909
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		42063.53	5.079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004430	3945500	MAG	Israel	Asia

• Gene Location: Start: 61; End: 1155 Strand: +

Full Sequence      

MVEVVVKDSGRQIASGRAVTGESVIVDMPAGVELWSPENPKLYDLEVRLMSDGRTLDKVD
SYAAMRKFSMKMGDKGVVRLQLNNRDLFHYGLLDQGWWPDGLYTAPSYEAMVFDVDKTKD
WGYNMIRKHIKVEPALWYAYCDRNGIIVWQDMPSGDKDPEWQGRNYFDGKELERTPESEA
NYRREWREIMDCLYSYPCIAMWVPFNEAWGQFKTREIADWTKNHDPSRLVNPASGGNFYP
CGDILDVHCYPSPPVTHVYDAKRANVLGEYGGIGMVADGHIWAPDREFSYINCKTPAELT
DRYIGYADYLDHLANEWFVGAVYTQTTDVEIEVNGLMTYDRKVIKIDENRIREVNKRIIK
NHSK

Enzyme Prediction     

No EC number prediction in MGYG000004430_02909.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.54e-18	1	282	215	482	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	3.13e-08	2	66	34	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK09525	lacZ	3.83e-06	2	245	257	500	beta-galactosidase.
pfam02836	Glyco_hydro_2_C	7.39e-05	111	342	38	285	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF13310.1	3.53e-235	1	364	242	605
AHF12404.1	4.21e-190	1	358	242	598
BBK86513.1	5.14e-177	2	358	194	549
SCD19982.1	1.02e-176	2	358	257	612
BCI64872.1	1.25e-176	2	364	242	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.20e-169	2	358	227	582	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3FN9_A	3.61e-13	34	235	247	433	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5UJ6_A	6.28e-08	33	207	261	418	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	6.30e-08	33	207	269	426	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
6D8G_A	1.11e-07	33	207	269	426	D341AD367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7MG04	1.72e-11	35	343	297	609	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1
Q8D4H3	1.72e-11	35	343	298	610	Beta-galactosidase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=lacZ PE=3 SV=2
A1SWB8	3.05e-11	35	343	300	616	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1
Q48727	2.23e-10	21	287	254	529	Beta-galactosidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=lacZ PE=3 SV=3
Q6LL68	3.00e-10	35	341	296	606	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004430_02909.