CAZyme Information: MGYG000004431_02117

Basic Information

• Species: COE1 sp001916965
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; COE1; COE1 sp001916965
• CAZyme ID: MGYG000004431_02117
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779		88732.77	5.2927

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004431	3494954	MAG	Israel	Asia

• Gene Location: Start: 33061; End: 35400 Strand: -

Full Sequence      

MKFSNGCWLQQEGCECFTPQQVYFSKIEENKVTLCAPTNRITHRGDTLGGINLTLVITSP
LPEVLRVQTYHHLGAVKKSPAFEINENCLPLTTSETEESITISSGSLTLEIGKNTWYMKY
MRNGKVITESRNRDLALMKTDWKGLAYDKGDNSDTYIRQQLSLGVGELVYGLGERFTPFV
KNGQSVDIWNADGGTSTEQSYKNIPFYLTNKGYGVFVNHPEKVSFEVGTEMVTKTEFSVE
GTYLDYFLINGPTMKEVLERYTDITGKPSLPAPWTFGLWLSTSFTTNYDEETVMSFVNGM
LDRGIPLRTFHFDCFWMKEFHWSDFLWDSRVFPDPVGMLKRIKEKGLNICVWINSYIGQE
SVLFKEGMEKGYFIKRPNGEVWQWDMWQPGMAIVDFTNPAAYKWFHDKLEILLDMGVDCF
KTDFGERIPTDAVYYDGSDPKKMHNYYTYLYNKCVYELLERKRGKGQAVLFARSATVGGQ
KFPVHWGGDCWSDYESMEESLRGGLSLCMSGFGFWAHDIGGFENTSTADVYKRWVAFGLL
SSHSRLHGSTSYRVPWVYDEEAVDVVRFFTRLKAKLMPYLYKTAITASRTGIPCMRSMVL
EYTEDKMCNYLDKQYMLGDNLLVAPIFNDESRAEYYLPAGIWTNFFTGKEYKGGTWVEEQ
HSYLSIPLMVRENSIIAIGAHDDKPDYDYADSCELRVYTLLDGVKAETTVYGMSNLPELT
VSAARSGHTIHVTAEGSKPYTIRMVNMHAAEAVNGFVVIEGNDSIITPDANASVIEIKF

Enzyme Prediction     

EC	3.2.1.177

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	246	676	3.9e-130	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	0.0	8	777	1	772	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06593	GH31_xylosidase_YicI	0.0	266	576	1	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
PRK10658	PRK10658	0.0	1	673	1	665	putative alpha-glucosidase; Provisional
pfam01055	Glyco_hydro_31	4.75e-179	247	676	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	2.92e-79	166	675	81	622	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF45281.1	0.0	1	769	1	771
QNU68449.1	0.0	1	768	1	769
CBL11696.1	0.0	1	775	13	790
VCV21669.1	0.0	1	775	1	778
CBL09656.1	0.0	1	775	1	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F2H_A	4.33e-306	1	747	1	741	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	5.17e-306	1	747	1	741	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
1WE5_A	1.59e-293	2	747	2	741	CrystalStructure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_B Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_C Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_D Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_E Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_F Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli]
5F7C_A	2.78e-113	167	697	202	738	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5F7U_A	1.82e-72	92	698	179	831	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31434	2.29e-305	1	747	1	741	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
Q5AW25	2.74e-242	1	734	1	757	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
P96793	3.42e-241	1	703	1	701	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
Q9F234	1.92e-77	95	763	88	770	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9P999	1.06e-61	52	698	5	644	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004431_02117.