CAZyme Information: MGYG000004432_00461

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA3263
• CAZyme ID: MGYG000004432_00461
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000004432_2|CGC1	36667.94	7.655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004432	2675051	MAG	Israel	Asia

• Gene Location: Start: 69395; End: 70381 Strand: -

Full Sequence      

MAKISVIILNWNGYNLLKEYLQRVLDATDPELSEVIVADNGSTDGSLDYVRWLGLRTICF
DENHGFAGGYNLALAEVDTPYTVLLNSDVAPCPGWDRALYDYMDAHPRCGACQPKILSWR
EPERFEYAGAAGGFLDRNGYPYCRGRIFGSVEVDRGQYDDPVEVDWASGAALMVRTALYR
EVGGLDESFFAHMEEIDLCWRMRLAGWTVAAVPSASVMHLGGGSLPMGNPRKTYLNFRNN
LLLLHKNLPDADRARALTRRRLLDTIAWVKSVMTFNFADAKAIVKAHRDYRTMAPAAKLS
GAGTNLLGGRPNILLKYFLARKTRFSQL

Enzyme Prediction     

No EC number prediction in MGYG000004432_00461.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	113	1.9e-18	0.6647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.34e-48	6	221	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.20e-45	1	224	2	224	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	4.14e-18	6	129	1	128	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	5.13e-18	5	113	1	113	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	4.70e-14	1	215	53	260	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP73803.1	8.22e-142	2	326	10	337
QCD40751.1	8.22e-142	2	326	10	337
QCD36115.1	9.65e-139	4	328	5	330
QQR09216.1	2.16e-138	5	328	10	334
ANU63451.1	2.16e-138	5	328	10	334

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	4.24e-19	17	219	18	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	4.24e-19	17	219	18	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
D4GU63	5.53e-12	4	242	20	247	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1
P9WMX0	1.07e-11	35	219	109	281	Pre-mycofactocin glycosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=mftF PE=3 SV=1
P9WMX1	1.07e-11	35	219	109	281	Pre-mycofactocin glycosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mftF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004432_00461.