CAZyme Information: MGYG000004432_01379

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA3263
• CAZyme ID: MGYG000004432_01379
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
162		18568.92	10.5892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004432	2675051	MAG	Israel	Asia

• Gene Location: Start: 57509; End: 57997 Strand: -

Full Sequence      

MKKLLFFFVALLSLVAATPAANAKRSIMELPPFERAVLIIKKFETLHKPKHWPYVGYGHQ
VQPGEPYRRGVQLTERQADALLRKDLRKFCALYSQYGKDSLLLACLAYNCGPGVVNKSSV
LKKLKAGNRDIFKAYTAHCRYKGKFHKQLHQRRLTEFAALFD

Enzyme Prediction     

No EC number prediction in MGYG000004432_01379.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	40	156	1e-16	0.9343065693430657

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	2.62e-16	36	162	1	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	3.88e-10	33	130	8	115	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16900	endolysin_R21-like	3.37e-07	36	127	8	107	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16901	lyz_P1	3.68e-07	49	158	24	137	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00959	Phage_lysozyme	9.54e-06	55	153	4	106	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36945.1	1.66e-108	1	162	1	162
QCP71761.1	6.87e-87	1	161	1	160
QCD40659.1	6.87e-87	1	161	1	160
QCD38079.1	6.87e-87	1	161	1	160
QCP71601.1	8.42e-79	1	161	1	160

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000221	0.999202	0.000143	0.000156	0.000138	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004432_01379.