CAZyme Information: MGYG000004433_00002

Basic Information

• Species: Bilophila sp900550745
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila sp900550745
• CAZyme ID: MGYG000004433_00002
• CAZy Family: GT2
• CAZyme Description: Gramicidin S synthase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2222	MGYG000004433_1|CGC1	245407.28	5.1013

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004433	3195755	MAG	Israel	Asia

• Gene Location: Start: 1143; End: 7811 Strand: -

Full Sequence      

MKDPAVIEYDSVRETIGGLIAEPGFSDGDNLVGLGLDSLKIMRLVSRWRKAGVKVTFAEM
IAEPTLSSWMEILRRKAGIGAERAVPASPLPQRTQDEPFPLTDVQYAYWIGRRDGQPLGG
VGCHAYLELDGEGVEPDRLARAWRTVLAHHSLLRAAFLEDGRQLVLPEPASEELIVHDLR
EADAGTVADRLERLREELSHRRFAVEQGRLAGLELCLLPDGRTRLFFDIDLLVADVQSFC
IVLRDLSAAYARGVVPPAPEAWRFSDYLARKDARDVADRERDAAYWAGRLPELPGAPALP
LKRNPEEVLRASYRRRLYFLPAGTWRALKAEAAAHEATAAMALLTAYAEILDRWSSVPRF
FINLPLFDRETGEEGLEDVVADFTNLLLVDVDCTEEKPFLGRLRDVQSRFYENVAHSSYS
GVRIQRDIARMRPDERFIAPVVFACNLGNPLLTQECRETLGRLHYMLSQTPQVWLDFQMY
ETEDGGLALAWDTAEELFAEGLIDEMLHAYGRLLEWLAADAAHWECVPDVLPERQRERRG
RDRALALPAPEETMHGPFFARAAEAADTVAVIDGLSGERITYGELAGEALRTAALLRRRG
VERGTPVAVTLPRGREQIVAVLGVLAAGGFYVPVSPSQPLARRERIHRKIGVRFVLSRTD
VLDAASLPSGAELIDIAERHAVVPLAEPAAVAPDDLAYVIFTSGSTGEPKGVAIEHHSAR
NTIADINGRFHVGEGDACLAVSSLDFDLSVYDIFGMLSSGAAIVAIGEAIRRSAGDWRRI
VLEYGVTVWNTVPILLDMLLVDAEAHGSRLPLRLAMLSGDWIGLDLPQRLKDAAPGARLI
AMGGATEASIWSNIMEVEAPIPAEWKSIPYGRPLSRQSYRVVDAKGRDCPDLVDGELWIG
GAGVARCYLGDPELTAQRFRNIDGMRWYRTGDLGRFWPDGTIEFLGRADSQVKIRGHRIE
LGEIEAALKEHPLVKDVVAMPVSGARGIRRLGAYLVLREPAADEEGLFRALEAFLRERVP
EYMVPSAFMALDALPLSANGKLDRKALPPFEEKACEEARPATELENALTRIWERILQVPQ
VGVRDNFFELGGDSLVATHLVAEVRKELGAELTLDRLFRFPDIARLAESLEAEARENGPA
LPDAASLPAVEPREGERSEPFPLTDVQYAYWIGRIGAYELGKVSSHVYFEFDNAGMDIER
LNGAWNRLIERHEMLRAVFLPDGTQAILPSVGEYRFPVYDLRDDAAPEGAIGNVRRAMSG
QLLPADTWPLFDIRVARYLRDGEERLRLFLDFDAMIADAWSIFLLVDEWLRLYRSPGERL
PELRLSFRDYVLAERKIVDTPLWRSDFEYWKKRLDDLPPAPELPLAKQPSELDAPRTVRL
SAVLEAPVWEGFKARIRRNGLTPSGLLVAAYAETLARWSAGPRFTLNLTLFNRLPLHDQV
NDVVGDFSSLNLLAVDAVSGASFRERALGVQRQLWEDMSHRLVSGVQVLRELALRGKPAR
MPIVFTGAVSLGKAGRDASGFSGMGTLVTSITQTPQVWLDHQTYEQEGRLMLNWDAVEGL
FPEGLVEAMFDAYVRLLNRLAADDAAWLEASPLTLPEAQRQSRIGYNATEGPLSGETLAS
LFLRQAQATPDAPAVITSARTLSYEEVLRRAGAIAHTLAHQGVSRGDLVGVVMEKGWEQV
VAVAGIALAGAVYVPVDAHVPYARLEQIADGAGFRTILTQAKYAEALRWPEGALVVAVDG
LPPEEGLPEAVPVEPDELAYIIYTSGSTGRPKGVAIDHRGAVNTLLDVNGRFGVGAGDRL
FGLSALHFDLSVYDIWGALLSGAAVVLPDADRLKDPSHWLELASRHGVTIWNSVPMLVQM
LVEYMEFAGKAGDVPLRLVLMSGDWIPLDLPRRIRAVAPEAKLFSLGGATEASIWSILYP
IGDVLPEWKSIPYGRPMRNQRFHVLNARLEACPDGVPGDLYIGGVGLAREYWRDAARTAE
SFIVHPETGERLYRTGDVGRMLRDGNIEFLGRKDFQVKIRGHRIELGEIEAVLLSRPDVR
EAVVAVAGENAAAKKLIAFIVPEGAVEERAVLGTVRERLPDYMVPSALVTLEALPLSGNG
KVDRKRLLQTAGEAAFQESAAAPASSEAEKAVGQAWEDVLGRAVLNIDDNFFDVGGTSVL
AVRLHRELARRFGREFPLVSVFEYPSIRTLAAFLDEGTRRAAPAAGTSRRVEMRKKRRAR
QG

Enzyme Prediction     

No EC number prediction in MGYG000004433_00002.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd19535	Cyc_NRPS	0.0	98	520	1	422	Cyc (heterocyclization) domain of nonribosomal peptide synthetases (NRPSs); belongs to the Condensation-domain family. Cyc (heterocyclization) domains catalyze two separate reactions in the creation of heterocyclized peptide products in nonribosomal peptide synthesis: amide bond formation followed by intramolecular cyclodehydration between a Cys, Ser, or Thr side chain and a carbonyl carbon on the peptide backbone to form a thiazoline, oxazoline, or methyloxazoline ring. Cyc-domains are homologous to standard NRPS Condensation (C) domains. C-domains typically have a conserved HHxxxD motif at the active site; Cyc-domains have an alternative, conserved DxxxxD active site motif, mutation of the aspartate residues in this motif can abolish or diminish condensation activity. NRPS can use a large variety of acyl monomers (approximately 500 different possible monomer substrates as opposed to the 20 standard amino acids in ribosomal protein synthesis) to construct bioactive secondary metabolites of 2 to 18 units long (with various activities such as antibiotic, antifungal, antitumor and immunosuppression). There are various subtypes of C-domains such as the LCL-type which catalyzes peptide bond formation between two L-amino acids, the DCL-type which links an L-amino acid to the D-amino acid at the end of a growing peptide, starter C-domains which acylate the first amino acid with a beta-hydroxy carboxylic acid, and Cyc-domains. Typically, an NRPS module consists of an adenylation domain, a peptidyl carrier protein (PCP) domain (also known as thiolation (T) domain) and a C-domain. NRPS modules may also include specialized domains such as the terminal-module thioesterase (Te) domain that releases the product via hydrolysis or macrocyclization and any of various C-domain family members such as the epimerization (E) domain, the ester-bond forming C-domain, dual E/C (epimerization and condensation) domains, and the X-domain.
PRK12467	PRK12467	0.0	127	2197	78	2166	peptide synthase; Provisional
cd19535	Cyc_NRPS	0.0	1160	1584	1	423	Cyc (heterocyclization) domain of nonribosomal peptide synthetases (NRPSs); belongs to the Condensation-domain family. Cyc (heterocyclization) domains catalyze two separate reactions in the creation of heterocyclized peptide products in nonribosomal peptide synthesis: amide bond formation followed by intramolecular cyclodehydration between a Cys, Ser, or Thr side chain and a carbonyl carbon on the peptide backbone to form a thiazoline, oxazoline, or methyloxazoline ring. Cyc-domains are homologous to standard NRPS Condensation (C) domains. C-domains typically have a conserved HHxxxD motif at the active site; Cyc-domains have an alternative, conserved DxxxxD active site motif, mutation of the aspartate residues in this motif can abolish or diminish condensation activity. NRPS can use a large variety of acyl monomers (approximately 500 different possible monomer substrates as opposed to the 20 standard amino acids in ribosomal protein synthesis) to construct bioactive secondary metabolites of 2 to 18 units long (with various activities such as antibiotic, antifungal, antitumor and immunosuppression). There are various subtypes of C-domains such as the LCL-type which catalyzes peptide bond formation between two L-amino acids, the DCL-type which links an L-amino acid to the D-amino acid at the end of a growing peptide, starter C-domains which acylate the first amino acid with a beta-hydroxy carboxylic acid, and Cyc-domains. Typically, an NRPS module consists of an adenylation domain, a peptidyl carrier protein (PCP) domain (also known as thiolation (T) domain) and a C-domain. NRPS modules may also include specialized domains such as the terminal-module thioesterase (Te) domain that releases the product via hydrolysis or macrocyclization and any of various C-domain family members such as the epimerization (E) domain, the ester-bond forming C-domain, dual E/C (epimerization and condensation) domains, and the X-domain.
PRK05691	PRK05691	0.0	29	2205	608	2783	peptide synthase; Validated
PRK12316	PRK12316	0.0	127	2198	1583	3626	peptide synthase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QND46664.1	1.35e-218	28	2206	463	2674
ACX49739.1	4.06e-119	248	1858	164	1818
AFZ04852.1	6.94e-99	1310	2196	285	1185
BAZ00088.1	4.16e-89	1310	2208	280	1190
BAZ75991.1	4.16e-89	1310	2208	280	1190

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EMY_A	4.47e-229	10	1073	13	1066	ChainA, Dihydroaeruginoic acid synthetase [Pseudomonas aeruginosa PAO1],7EMY_B Chain B, Dihydroaeruginoic acid synthetase [Pseudomonas aeruginosa PAO1],7EN1_A Chain A, Dihydroaeruginoic acid synthetase [Pseudomonas aeruginosa PAO1],7EN1_B Chain B, Dihydroaeruginoic acid synthetase [Pseudomonas aeruginosa PAO1],7EN2_A Chain A, Dihydroaeruginoic acid synthetase [Pseudomonas aeruginosa PAO1],7EN2_B Chain B, Dihydroaeruginoic acid synthetase [Pseudomonas aeruginosa PAO1]
6LTA_A	1.09e-225	1137	2206	31	1105	ChainA, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23],6LTB_A Chain A, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23],6LTC_A Chain A, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23],6LTD_A Chain A, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23],6LTD_B Chain B, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23]
7LY7_A	7.06e-223	1154	2191	4	1013	ChainA, BmdB, Bacillamide NRPS [Thermoactinomyces vulgaris]
7LY4_E	7.28e-223	1154	2191	4	1013	ChainE, BmdB, bacillamide NRPS [Thermoactinomyces vulgaris]
6MFZ_A	9.55e-194	551	2194	204	1797	Crystalstructure of dimodular LgrA in a condensation state [Brevibacillus parabrevis],6MFZ_B Crystal structure of dimodular LgrA in a condensation state [Brevibacillus parabrevis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48633	1.99e-318	27	1587	41	1909	High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=irp2 PE=3 SV=1
O68006	6.98e-300	552	2194	37	1651	Bacitracin synthase 1 OS=Bacillus licheniformis OX=1402 GN=bacA PE=3 SV=1
A0A0H2ZGB9	3.01e-230	10	1073	13	1066	Pyochelin synthase PchE OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=pchE PE=1 SV=1
G3XCV2	1.57e-228	10	1073	13	1066	Pyochelin synthase PchE OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pchE PE=1 SV=1
Q7TYQ4	2.25e-224	12	1130	15	1131	Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=mbtB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004433_00002.