CAZyme Information: MGYG000004433_01504

Basic Information

• Species: Bilophila sp900550745
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila sp900550745
• CAZyme ID: MGYG000004433_01504
• CAZy Family: GH103
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336		36384.83	9.9429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004433	3195755	MAG	Israel	Asia

• Gene Location: Start: 1640; End: 2650 Strand: -

Full Sequence      

MIRRALSAVLLLLALAGAGCSQNRIVYAQPGAQAQPPQYPSYQGSYTGTAIPPAWLPLYQ
RLRADGLDGPDLPVLFASMGMPSQDPMGRKIKELYTKAFAPKPKPAPPSAKPAAPARPKP
LVYPGVITAGNVEKCRAFLEANKPAFDYAERTFGVPRQISVSLLFVETRLGTFLGKEKAF
YTLASMASSRRPEAISTYVAQLPGSAAANRQSWIQQRMEQRSDWAYKELVALLKNIRASG
EDALSMPGSIYGAVGLCQFMPTNISHYGADGNGDGVVNLFDVPDAVASLSNYLARHGWNK
AATRAQKQKVIKTYNRIDIYANTILGLAEAQGYVAE

Enzyme Prediction     

No EC number prediction in MGYG000004433_01504.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	123	306	8.9e-42	0.5254237288135594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	1.05e-46	123	329	54	232	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
COG2951	MltB	3.34e-32	125	332	95	281	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
PRK10760	PRK10760	1.27e-23	127	305	120	270	murein hydrolase B; Provisional
cd13399	Slt35-like	4.29e-23	246	330	22	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADP85790.1	2.79e-97	28	335	31	334
AAS95158.1	2.79e-97	28	335	31	334
ABM29301.1	1.12e-96	28	335	31	334
ATD81641.1	2.40e-91	29	329	82	375
SPD34368.1	2.40e-91	29	329	82	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1LTM_A	6.78e-19	127	300	81	226	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]
1D0K_A	6.95e-19	127	300	83	228	ChainA, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0L_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0M_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1QDR_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QDT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUS_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli]
5O8X_A	1.83e-15	142	298	74	205	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	2.16e-15	142	298	91	222	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5ANZ_A	3.62e-09	125	298	102	247	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	5.72e-18	127	300	122	267	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000075	0.999991	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004433_01504.