CAZyme Information: MGYG000004434_01380

Basic Information

• Species: UMGS1707 sp900554285
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-314; UMGS1707; UMGS1707 sp900554285
• CAZyme ID: MGYG000004434_01380
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309		35644.08	8.8431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004434	1654850	MAG	Israel	Asia

• Gene Location: Start: 11847; End: 12776 Strand: -

Full Sequence      

MPMNSVCVLLSTYNGEKYLTPLLDSVVSQKGVALSVVARDDGSKDNTPSILSRYKEQGKI
TRLITDSNVGFARSFHRLCTEAVPSDYYAFCDQDDIWDSDKLLCAVEKLNACPNDIPLVY
WCAFRSIDKNGKVYKQRSKRLIFRNQYNPLANSLNCNDVRGCTCVFNQKAMDMILTLKEG
SYRYHDWTLLLIASAFGMDVHDPEPHISYRCHDTNCYGPLKFNFQSLKRGIKYVFNVELN
HNRSKEAQEMLELFGDKLSPEQLHYVQCAANYLKNKKIKKQLLKCKRELNAIPAPMRWFI
KFAIHTNKY

Enzyme Prediction     

No EC number prediction in MGYG000004434_01380.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	170	7.5e-20	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04196	GT_2_like_d	4.00e-60	8	215	2	208	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.99e-17	7	170	1	163	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.29e-14	8	129	1	121	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	9.88e-13	1	236	2	222	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
COG1216	GT2	1.11e-09	3	144	2	140	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL39230.1	1.74e-49	3	305	1	298
ABO51541.1	2.58e-47	3	287	1	287
QHH90504.1	8.67e-47	3	282	1	276
QUU09196.1	7.71e-45	3	275	1	271
QQY28482.1	1.59e-41	6	282	20	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BCV_A	1.81e-08	6	100	7	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
3L7I_A	9.03e-08	3	110	1	109	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
2Z86_A	2.70e-07	6	218	377	575	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	2.70e-07	6	218	376	574	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
5TZE_C	2.01e-06	8	119	5	118	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37783	7.20e-12	10	218	1	212	dTDP-rhamnosyl transferase RfbG OS=Shigella flexneri OX=623 GN=rfbG PE=3 SV=1
Q9ZDI9	2.80e-08	6	212	10	212	Uncharacterized glycosyltransferase RP339 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP339 PE=3 SV=1
P22639	1.23e-07	6	107	3	104	Uncharacterized glycosyltransferase alr2836 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=alr2836 PE=3 SV=2
Q8L0V4	1.53e-06	6	218	434	632	Chondroitin synthase OS=Escherichia coli OX=562 GN=kfoC PE=1 SV=1
Q57287	4.10e-06	6	258	7	248	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004434_01380.